BLASTX nr result
ID: Bupleurum21_contig00032612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00032612 (371 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517994.1| conserved hypothetical protein [Ricinus comm... 84 1e-14 ref|XP_002525615.1| conserved hypothetical protein [Ricinus comm... 74 1e-11 ref|XP_002525617.1| conserved hypothetical protein [Ricinus comm... 74 2e-11 ref|XP_002525618.1| conserved hypothetical protein [Ricinus comm... 73 2e-11 ref|XP_002525614.1| conserved hypothetical protein [Ricinus comm... 73 2e-11 >ref|XP_002517994.1| conserved hypothetical protein [Ricinus communis] gi|223542976|gb|EEF44512.1| conserved hypothetical protein [Ricinus communis] Length = 95 Score = 84.0 bits (206), Expect = 1e-14 Identities = 39/73 (53%), Positives = 53/73 (72%), Gaps = 4/73 (5%) Frame = -2 Query: 265 VSTAESGGITLGIGFKNVV----CNKVYGAESGDTCSTISSALNITPQLFSSINPNLNCS 98 +STA+ G LGIGF + C+ VYGA+ GDTC+++++ N+T + FSSINPNLNC Sbjct: 24 ISTAQ--GKKLGIGFGDAKSTPECDSVYGAQDGDTCTSVANQFNLTLEFFSSINPNLNCD 81 Query: 97 NIFVSEWLCINGT 59 + FV +WLCINGT Sbjct: 82 DFFVGQWLCINGT 94 >ref|XP_002525615.1| conserved hypothetical protein [Ricinus communis] gi|223535051|gb|EEF36733.1| conserved hypothetical protein [Ricinus communis] Length = 96 Score = 73.9 bits (180), Expect = 1e-11 Identities = 33/72 (45%), Positives = 49/72 (68%), Gaps = 3/72 (4%) Frame = -2 Query: 265 VSTAESGGITLGIGF---KNVVCNKVYGAESGDTCSTISSALNITPQLFSSINPNLNCSN 95 +STA+ I++G C+ VYGA+ GDTC+++++ ++T + FSSINPNLNC Sbjct: 24 ISTAQCRQISIGSSGDAKSTPECDSVYGAQDGDTCTSVATQFDLTLEFFSSINPNLNCDA 83 Query: 94 IFVSEWLCINGT 59 IFV +WLC +GT Sbjct: 84 IFVGQWLCADGT 95 >ref|XP_002525617.1| conserved hypothetical protein [Ricinus communis] gi|223535053|gb|EEF36735.1| conserved hypothetical protein [Ricinus communis] Length = 96 Score = 73.6 bits (179), Expect = 2e-11 Identities = 29/51 (56%), Positives = 41/51 (80%) Frame = -2 Query: 208 CNKVYGAESGDTCSTISSALNITPQLFSSINPNLNCSNIFVSEWLCINGTL 56 C+ VYGA+ GDTC++I++ ++T + FSSINPNLNC IFV +WLC +GT+ Sbjct: 46 CDSVYGAQDGDTCTSIATQFDLTLEFFSSINPNLNCDAIFVGQWLCTDGTV 96 >ref|XP_002525618.1| conserved hypothetical protein [Ricinus communis] gi|223535054|gb|EEF36736.1| conserved hypothetical protein [Ricinus communis] Length = 104 Score = 73.2 bits (178), Expect = 2e-11 Identities = 31/61 (50%), Positives = 44/61 (72%), Gaps = 4/61 (6%) Frame = -2 Query: 229 IGFKNVV----CNKVYGAESGDTCSTISSALNITPQLFSSINPNLNCSNIFVSEWLCING 62 +GF N C+ VYGA+ GDTC+++++ ++T + FSSINPNLNC IFV +WLC +G Sbjct: 43 VGFGNAKSTPECDSVYGAQDGDTCTSLAAQFDLTLEFFSSINPNLNCDAIFVGQWLCTDG 102 Query: 61 T 59 T Sbjct: 103 T 103 >ref|XP_002525614.1| conserved hypothetical protein [Ricinus communis] gi|223535050|gb|EEF36732.1| conserved hypothetical protein [Ricinus communis] Length = 104 Score = 73.2 bits (178), Expect = 2e-11 Identities = 31/61 (50%), Positives = 44/61 (72%), Gaps = 4/61 (6%) Frame = -2 Query: 229 IGFKNVV----CNKVYGAESGDTCSTISSALNITPQLFSSINPNLNCSNIFVSEWLCING 62 +GF N C+ VYGA+ GDTC+++++ ++T + FSSINPNLNC IFV +WLC +G Sbjct: 43 VGFGNAKSTPECDSVYGAQDGDTCTSLAAQFDLTLEFFSSINPNLNCDAIFVGQWLCTDG 102 Query: 61 T 59 T Sbjct: 103 T 103