BLASTX nr result
ID: Bupleurum21_contig00032516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00032516 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002465463.1| hypothetical protein SORBIDRAFT_01g039290 [S... 55 5e-06 ref|XP_003625508.1| RNA binding protein [Medicago truncatula] gi... 55 6e-06 >ref|XP_002465463.1| hypothetical protein SORBIDRAFT_01g039290 [Sorghum bicolor] gi|241919317|gb|EER92461.1| hypothetical protein SORBIDRAFT_01g039290 [Sorghum bicolor] Length = 169 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/63 (42%), Positives = 36/63 (57%) Frame = -2 Query: 318 GVLDLTTGDKLPAAFAPFGNVLELRICKGGPYGNSKGTAIIKYGTKEEDEKAHDALEDNL 139 G+ LTT +KL AFAPFG +LE ++ G SKG ++Y T EE EKA + Sbjct: 69 GLSRLTTDEKLQGAFAPFGRILEAKVVTDRVSGRSKGFGFVRYATIEEAEKARQEMNAKF 128 Query: 138 LEG 130 L+G Sbjct: 129 LDG 131 >ref|XP_003625508.1| RNA binding protein [Medicago truncatula] gi|355500523|gb|AES81726.1| RNA binding protein [Medicago truncatula] Length = 141 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/63 (42%), Positives = 37/63 (58%) Frame = -2 Query: 318 GVLDLTTGDKLPAAFAPFGNVLELRICKGGPYGNSKGTAIIKYGTKEEDEKAHDALEDNL 139 G+ LTT +KL AF+PFG +LE ++ G SKG A + Y T EE EKA + + Sbjct: 41 GLSRLTTDEKLTEAFSPFGQLLEAKVITDRGSGRSKGFAFVSYSTIEEAEKAREGMNAKF 100 Query: 138 LEG 130 L+G Sbjct: 101 LDG 103