BLASTX nr result
ID: Bupleurum21_contig00032411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00032411 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273501.2| PREDICTED: sterol 3-beta-glucosyltransferase... 59 3e-07 >ref|XP_002273501.2| PREDICTED: sterol 3-beta-glucosyltransferase-like [Vitis vinifera] Length = 599 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/59 (44%), Positives = 40/59 (67%) Frame = -2 Query: 258 EWQYSCSQCQKISKALFSPHLNTKDSLCPSHSELQSFLMSSASTSLVFVGLSSVGRQVF 82 EW++SC++C +IS ++ +N + +CP+H+ LQSFL + A VF+GLSSVG F Sbjct: 343 EWEFSCNKCGEISASISLRRVNAEVEMCPAHTMLQSFLKTPAPMPPVFIGLSSVGSMGF 401