BLASTX nr result
ID: Bupleurum21_contig00032401
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00032401 (353 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003523026.1| PREDICTED: sexual differentiation process pr... 55 5e-06 >ref|XP_003523026.1| PREDICTED: sexual differentiation process protein isp7-like [Glycine max] Length = 314 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/41 (58%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 353 IGKPAEYRGFYFKDYQAMRMRPKFNPPYRP-DDVKITHYSI 234 IG+P +YRGF +K+YQ +RMR K +PP RP D++ ITHY+I Sbjct: 272 IGEPPKYRGFLYKEYQELRMRNKSHPPSRPEDEIHITHYAI 312