BLASTX nr result
ID: Bupleurum21_contig00032225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00032225 (465 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003599510.1| Serine carboxypeptidase-like protein [Medica... 55 8e-06 >ref|XP_003599510.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355488558|gb|AES69761.1| Serine carboxypeptidase-like protein [Medicago truncatula] Length = 497 Score = 54.7 bits (130), Expect = 8e-06 Identities = 31/70 (44%), Positives = 44/70 (62%), Gaps = 7/70 (10%) Frame = -3 Query: 190 HSKIKVKYLNKLYKAK-----GVDKSNFEPYLHDHEDVETSYHVES--KEKDKIVKLPGQ 32 H ++K LNKL K+K +D S+F+ +H++ ++ H + KEKDKI KLPGQ Sbjct: 24 HGSKQIKALNKLQKSKYSTNSQIDTSHFK--IHENIALDPMVHSQDGMKEKDKIEKLPGQ 81 Query: 31 PRVQFDQYGG 2 P V+F QYGG Sbjct: 82 PNVKFSQYGG 91