BLASTX nr result
ID: Bupleurum21_contig00032208
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00032208 (481 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266358.1| PREDICTED: S-adenosylmethionine synthase 2 [... 66 3e-09 emb|CAN75334.1| hypothetical protein VITISV_002362 [Vitis vinifera] 66 3e-09 emb|CAN75687.1| hypothetical protein VITISV_034977 [Vitis vinifera] 66 3e-09 gb|AFW80645.1| S-adenosylmethionine synthase isoform 1 [Zea mays... 66 3e-09 ref|XP_003567624.1| PREDICTED: S-adenosylmethionine synthase 1-l... 66 3e-09 >ref|XP_002266358.1| PREDICTED: S-adenosylmethionine synthase 2 [Vitis vinifera] gi|223635284|sp|A7NVX9.1|METK2_VITVI RecName: Full=S-adenosylmethionine synthase 2; Short=AdoMet synthase 2; AltName: Full=Methionine adenosyltransferase 2; Short=MAT 2 Length = 393 Score = 66.2 bits (160), Expect = 3e-09 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 7/61 (11%) Frame = -3 Query: 479 RVSANYGKIVCDTCREIGFVSDDVELDAN-----INFEQRSPHITQGV--HQTKKSEDIG 321 + + +Y KIV DTCREIGFVSDDV LDA+ +N EQ+SP I QGV H TK+ E+IG Sbjct: 60 KANVDYEKIVRDTCREIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 119 Query: 320 A 318 A Sbjct: 120 A 120 >emb|CAN75334.1| hypothetical protein VITISV_002362 [Vitis vinifera] Length = 393 Score = 66.2 bits (160), Expect = 3e-09 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 7/61 (11%) Frame = -3 Query: 479 RVSANYGKIVCDTCREIGFVSDDVELDAN-----INFEQRSPHITQGV--HQTKKSEDIG 321 + + +Y KIV DTCREIGFVSDDV LDA+ +N EQ+SP I QGV H TK+ E+IG Sbjct: 60 KANVDYEKIVRDTCREIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 119 Query: 320 A 318 A Sbjct: 120 A 120 >emb|CAN75687.1| hypothetical protein VITISV_034977 [Vitis vinifera] Length = 393 Score = 66.2 bits (160), Expect = 3e-09 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 7/61 (11%) Frame = -3 Query: 479 RVSANYGKIVCDTCREIGFVSDDVELDAN-----INFEQRSPHITQGV--HQTKKSEDIG 321 + + +Y KIV DTCREIGFVSDDV LDA+ +N EQ+SP I QGV H TK+ E+IG Sbjct: 60 KANVDYEKIVRDTCREIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 119 Query: 320 A 318 A Sbjct: 120 A 120 >gb|AFW80645.1| S-adenosylmethionine synthase isoform 1 [Zea mays] gi|413947997|gb|AFW80646.1| S-adenosylmethionine synthase isoform 2 [Zea mays] gi|413947998|gb|AFW80647.1| S-adenosylmethionine synthase isoform 3 [Zea mays] gi|413947999|gb|AFW80648.1| S-adenosylmethionine synthase isoform 4 [Zea mays] gi|413948000|gb|AFW80649.1| S-adenosylmethionine synthase isoform 5 [Zea mays] Length = 392 Score = 65.9 bits (159), Expect = 3e-09 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 7/61 (11%) Frame = -3 Query: 479 RVSANYGKIVCDTCREIGFVSDDVELDAN-----INFEQRSPHITQGVHQ--TKKSEDIG 321 + S +Y KIV DTCREIGF SDDV LDA+ +N EQ+SP I QGVH TK+ E+IG Sbjct: 62 KASVDYEKIVRDTCREIGFTSDDVGLDADRCKVLVNIEQQSPDIAQGVHGHFTKRPEEIG 121 Query: 320 A 318 A Sbjct: 122 A 122 >ref|XP_003567624.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 1 [Brachypodium distachyon] gi|357132009|ref|XP_003567625.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 2 [Brachypodium distachyon] gi|357132011|ref|XP_003567626.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 3 [Brachypodium distachyon] Length = 394 Score = 65.9 bits (159), Expect = 3e-09 Identities = 36/66 (54%), Positives = 45/66 (68%), Gaps = 7/66 (10%) Frame = -3 Query: 479 RVSANYGKIVCDTCREIGFVSDDVELDAN-----INFEQRSPHITQGVHQ--TKKSEDIG 321 + + +Y KIV DTCR IGF+SDDV LDA+ +N EQ+SP I QGVH TK+ EDIG Sbjct: 62 KATVDYEKIVRDTCRNIGFISDDVGLDADRCKVLVNIEQQSPDIAQGVHGHFTKRPEDIG 121 Query: 320 ADFRNI 303 A + I Sbjct: 122 AGDQGI 127