BLASTX nr result
ID: Bupleurum21_contig00032087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00032087 (426 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17998.3| unnamed protein product [Vitis vinifera] 122 4e-26 ref|XP_002277219.1| PREDICTED: G-type lectin S-receptor-like ser... 122 4e-26 ref|XP_002325680.1| predicted protein [Populus trichocarpa] gi|2... 119 2e-25 ref|XP_002514691.1| S-locus-specific glycoprotein S6 precursor, ... 117 1e-24 ref|XP_002513231.1| s-receptor kinase, putative [Ricinus communi... 115 3e-24 >emb|CBI17998.3| unnamed protein product [Vitis vinifera] Length = 638 Score = 122 bits (305), Expect = 4e-26 Identities = 57/81 (70%), Positives = 68/81 (83%) Frame = -1 Query: 243 GADTISANQSISGDQTIVSSGENFKLGFFKPGKSSKYYIGIWYNKVSTQTIAWIANREQY 64 G DTIS N+++SGDQT+VS+G NF LGFFKPG SS YYIG+WY KVS QTI W+ANR+ Sbjct: 91 GGDTISGNETLSGDQTLVSAGGNFVLGFFKPGNSSYYYIGMWYKKVSEQTIVWVANRDTP 150 Query: 63 VSDNFSSQLKIVDGNLVLVDE 1 V+DN SSQLKI+DGNLVL +E Sbjct: 151 VTDNRSSQLKILDGNLVLFNE 171 >ref|XP_002277219.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130 isoform 1 [Vitis vinifera] Length = 826 Score = 122 bits (305), Expect = 4e-26 Identities = 57/81 (70%), Positives = 68/81 (83%) Frame = -1 Query: 243 GADTISANQSISGDQTIVSSGENFKLGFFKPGKSSKYYIGIWYNKVSTQTIAWIANREQY 64 G DTIS N+++SGDQT+VS+G NF LGFFKPG SS YYIG+WY KVS QTI W+ANR+ Sbjct: 27 GGDTISGNETLSGDQTLVSAGGNFVLGFFKPGNSSYYYIGMWYKKVSEQTIVWVANRDTP 86 Query: 63 VSDNFSSQLKIVDGNLVLVDE 1 V+DN SSQLKI+DGNLVL +E Sbjct: 87 VTDNRSSQLKILDGNLVLFNE 107 >ref|XP_002325680.1| predicted protein [Populus trichocarpa] gi|222862555|gb|EEF00062.1| predicted protein [Populus trichocarpa] Length = 824 Score = 119 bits (299), Expect = 2e-25 Identities = 58/83 (69%), Positives = 69/83 (83%), Gaps = 2/83 (2%) Frame = -1 Query: 243 GADTISANQSISGDQTIVSSGENFKLGFFKPGKSSKYYIGIWY--NKVSTQTIAWIANRE 70 GADTISAN S+SGDQT+VS+G+ F+LGFFKPG SS YYIG+WY +KVS QTI W+ANRE Sbjct: 27 GADTISANSSLSGDQTVVSAGKVFELGFFKPGNSSNYYIGMWYYRDKVSAQTIVWVANRE 86 Query: 69 QYVSDNFSSQLKIVDGNLVLVDE 1 VSD FSS+L+I DGNL L +E Sbjct: 87 TPVSDRFSSELRISDGNLALFNE 109 >ref|XP_002514691.1| S-locus-specific glycoprotein S6 precursor, putative [Ricinus communis] gi|223546295|gb|EEF47797.1| S-locus-specific glycoprotein S6 precursor, putative [Ricinus communis] Length = 779 Score = 117 bits (293), Expect = 1e-24 Identities = 55/81 (67%), Positives = 66/81 (81%) Frame = -1 Query: 243 GADTISANQSISGDQTIVSSGENFKLGFFKPGKSSKYYIGIWYNKVSTQTIAWIANREQY 64 GAD ISANQ++SGDQ + S G F LGFFKPG SS YYIGIWYNK+S QTI W+ANRE+ Sbjct: 28 GADKISANQTLSGDQIVSSEGGKFVLGFFKPGNSSNYYIGIWYNKLSPQTIVWVANREKP 87 Query: 63 VSDNFSSQLKIVDGNLVLVDE 1 V D +SS+L+I +GNLVLV+E Sbjct: 88 VLDKYSSELRISNGNLVLVNE 108 >ref|XP_002513231.1| s-receptor kinase, putative [Ricinus communis] gi|223547605|gb|EEF49099.1| s-receptor kinase, putative [Ricinus communis] Length = 594 Score = 115 bits (289), Expect = 3e-24 Identities = 55/82 (67%), Positives = 65/82 (79%) Frame = -1 Query: 246 FGADTISANQSISGDQTIVSSGENFKLGFFKPGKSSKYYIGIWYNKVSTQTIAWIANREQ 67 F AD I+A Q +SGDQTIVS+G FKLGFF PG SSK+YIGIWYN+VS +T W+ANR Sbjct: 28 FAADKITATQPLSGDQTIVSAGGVFKLGFFNPGNSSKFYIGIWYNRVSQRTFVWVANRAT 87 Query: 66 YVSDNFSSQLKIVDGNLVLVDE 1 VSD FSS+L+I DGNLVL +E Sbjct: 88 PVSDKFSSELRISDGNLVLFNE 109