BLASTX nr result
ID: Bupleurum21_contig00032051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00032051 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280555.2| PREDICTED: dehydration-responsive element-bi... 74 1e-11 ref|XP_002283864.1| PREDICTED: dehydration-responsive element-bi... 65 8e-09 gb|ADE41142.1| AP2 domain class transcription factor [Malus x do... 61 8e-08 gb|ADE41132.1| AP2 domain class transcription factor [Malus x do... 60 1e-07 ref|XP_004161329.1| PREDICTED: dehydration-responsive element-bi... 55 5e-06 >ref|XP_002280555.2| PREDICTED: dehydration-responsive element-binding protein 3-like [Vitis vinifera] Length = 266 Score = 73.9 bits (180), Expect = 1e-11 Identities = 40/95 (42%), Positives = 53/95 (55%), Gaps = 13/95 (13%) Frame = -3 Query: 268 LVTNEEAASPEELGEIVELPRLGCSFETVGSTNEFLFAEADDGWFFYSPPWLQGVEDFTG 89 L++ +A++PEELGEIVELP LG SFET S N+F+F ++ DGW Y PPWL + Sbjct: 185 LISTSDASTPEELGEIVELPSLGTSFETPESGNDFVFVDSVDGW-LYPPPWLHTAD---- 239 Query: 88 GGMTAAEIDCGSF-------------SYDTLLWQY 23 DCG F S++ LLW+Y Sbjct: 240 --------DCGYFSEHLPITDTLIPTSFEALLWEY 266 >ref|XP_002283864.1| PREDICTED: dehydration-responsive element-binding protein 3-like [Vitis vinifera] Length = 241 Score = 64.7 bits (156), Expect = 8e-09 Identities = 41/104 (39%), Positives = 54/104 (51%) Frame = -3 Query: 343 AAKAAAMDHLXXXXXXXXXXXXXSLLVTNEEAASPEELGEIVELPRLGCSFETVGSTNEF 164 AAKAAAMD SL+ + + + + +EL EIVELP L SF++ S +F Sbjct: 134 AAKAAAMDKFDSPSSSSSSSSLSSLVSSIDLSTASDELSEIVELPNLDPSFDSPESKTDF 193 Query: 163 LFAEADDGWFFYSPPWLQGVEDFTGGGMTAAEIDCGSFSYDTLL 32 +F ++ DGW Y PPWLQ VE DCG FS L+ Sbjct: 194 VFDDSADGW-LYPPPWLQSVE------------DCGYFSEQLLV 224 >gb|ADE41142.1| AP2 domain class transcription factor [Malus x domestica] Length = 252 Score = 61.2 bits (147), Expect = 8e-08 Identities = 34/72 (47%), Positives = 45/72 (62%) Frame = -3 Query: 238 EELGEIVELPRLGCSFETVGSTNEFLFAEADDGWFFYSPPWLQGVEDFTGGGMTAAEIDC 59 +EL EIVELP L S+E+ +EF+F E++D W Y PPWLQ VE+F G + AA Sbjct: 186 DELSEIVELPSL--SYESTELRSEFVFVESEDQWV-YPPPWLQRVEEFECGELGAA---- 238 Query: 58 GSFSYDTLLWQY 23 S ++ LLW Y Sbjct: 239 SSVGFEGLLWDY 250 >gb|ADE41132.1| AP2 domain class transcription factor [Malus x domestica] Length = 278 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/49 (55%), Positives = 38/49 (77%) Frame = -3 Query: 262 TNEEAASPEELGEIVELPRLGCSFETVGSTNEFLFAEADDGWFFYSPPW 116 T+ +A +PEELGEIV+LP LG S+E+ S +EF+FA++ +GW Y PPW Sbjct: 186 TSGDAGTPEELGEIVKLPSLGTSYESAESGSEFVFADSVEGW-LYPPPW 233 >ref|XP_004161329.1| PREDICTED: dehydration-responsive element-binding protein 3-like [Cucumis sativus] Length = 250 Score = 55.5 bits (132), Expect = 5e-06 Identities = 32/72 (44%), Positives = 42/72 (58%) Frame = -3 Query: 247 ASPEELGEIVELPRLGCSFETVGSTNEFLFAEADDGWFFYSPPWLQGVEDFTGGGMTAAE 68 +SPEEL EIVELP LG S+ET NEF+F ++ +GW YS PW V + + + Sbjct: 170 SSPEELTEIVELPSLGTSYETAELGNEFVFVDSVEGW-LYSYPWYNRVSN--AEQVEELQ 226 Query: 67 IDCGSFSYDTLL 32 D G F D +L Sbjct: 227 EDYGLFFKDQIL 238