BLASTX nr result
ID: Bupleurum21_contig00032038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00032038 (359 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22269.3| unnamed protein product [Vitis vinifera] 61 1e-07 ref|XP_002278886.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_002305377.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 ref|XP_004155878.1| PREDICTED: pentatricopeptide repeat-containi... 58 7e-07 ref|XP_004134328.1| PREDICTED: pentatricopeptide repeat-containi... 58 7e-07 >emb|CBI22269.3| unnamed protein product [Vitis vinifera] Length = 509 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -3 Query: 357 SIELDNEVHEFTVVDKSHPKSERIYEMINGLSQHLKK 247 SIE+D+EVHEFTV D+SHPKS+RIY+ I+GL QH+ K Sbjct: 468 SIEVDDEVHEFTVFDRSHPKSDRIYKTIDGLGQHINK 504 >ref|XP_002278886.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Vitis vinifera] Length = 594 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -3 Query: 357 SIELDNEVHEFTVVDKSHPKSERIYEMINGLSQHLKK 247 SIE+D+EVHEFTV D+SHPKS+RIY+ I+GL QH+ K Sbjct: 553 SIEVDDEVHEFTVFDRSHPKSDRIYKTIDGLGQHINK 589 >ref|XP_002305377.1| predicted protein [Populus trichocarpa] gi|222848341|gb|EEE85888.1| predicted protein [Populus trichocarpa] Length = 427 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = -3 Query: 357 SIELDNEVHEFTVVDKSHPKSERIYEMINGLSQHLKKDAYIANEIY 220 SIE+D+EVHEFTV DKSHPKS++IY+MIN L LK+ ++ ++Y Sbjct: 382 SIEVDDEVHEFTVFDKSHPKSDKIYQMINRLGLDLKR-VHVVPKVY 426 >ref|XP_004155878.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Cucumis sativus] Length = 561 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -3 Query: 357 SIELDNEVHEFTVVDKSHPKSERIYEMINGLSQHLKKDAYIAN 229 SIE++NEVHEFTV D+SHPKS+ IY++INGL LK+ +N Sbjct: 517 SIEVNNEVHEFTVFDRSHPKSDNIYQVINGLRHELKQVECFSN 559 >ref|XP_004134328.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Cucumis sativus] Length = 601 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -3 Query: 357 SIELDNEVHEFTVVDKSHPKSERIYEMINGLSQHLKKDAYIAN 229 SIE++NEVHEFTV D+SHPKS+ IY++INGL LK+ +N Sbjct: 557 SIEVNNEVHEFTVFDRSHPKSDNIYQVINGLRHELKQVECFSN 599