BLASTX nr result
ID: Bupleurum21_contig00032036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00032036 (251 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003537459.1| PREDICTED: E3 ubiquitin-protein ligase RING1... 56 3e-06 >ref|XP_003537459.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max] Length = 393 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/59 (49%), Positives = 36/59 (61%) Frame = +1 Query: 70 IYIYNFGTNSDQNSTPELSRTRRIGGNRSPFNPVFVLRGNAVNGGSGSEQAGEDGSGSG 246 +Y+ +SD L RTRR GG+RSPFNPV VLRG A + G E +DG+GSG Sbjct: 63 MYMIGQRPSSDPRPASSLRRTRRNGGDRSPFNPVIVLRGGAEDESRGFELFYDDGTGSG 121