BLASTX nr result
ID: Bupleurum21_contig00032000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00032000 (519 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512849.1| ATP binding protein, putative [Ricinus commu... 74 9e-12 ref|XP_002512746.1| Mitogen-activated protein kinase kinase kina... 72 6e-11 ref|XP_002332066.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 ref|XP_002303860.1| predicted protein [Populus trichocarpa] gi|2... 68 9e-10 ref|XP_002513021.1| ATP binding protein, putative [Ricinus commu... 67 1e-09 >ref|XP_002512849.1| ATP binding protein, putative [Ricinus communis] gi|223547860|gb|EEF49352.1| ATP binding protein, putative [Ricinus communis] Length = 320 Score = 74.3 bits (181), Expect = 9e-12 Identities = 34/58 (58%), Positives = 45/58 (77%) Frame = +3 Query: 3 DLEANDLLERIADGREMPKIPNEISIEAKNFLKGCLVRKPMYRLTAEMLLNHPFLEGL 176 D+ N+LLE+I + E PK+P++IS + K+FLK CLV+K +R TAEMLLNHPFL GL Sbjct: 235 DMTTNELLEKIGECYEPPKMPSQISKDGKDFLKRCLVKKSAFRFTAEMLLNHPFLSGL 292 >ref|XP_002512746.1| Mitogen-activated protein kinase kinase kinase, putative [Ricinus communis] gi|223547757|gb|EEF49249.1| Mitogen-activated protein kinase kinase kinase, putative [Ricinus communis] Length = 369 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/56 (57%), Positives = 45/56 (80%) Frame = +3 Query: 18 DLLERIADGREMPKIPNEISIEAKNFLKGCLVRKPMYRLTAEMLLNHPFLEGLVDA 185 +L++RI D E+P IP+EIS + K+FLK CLV+KP +R T+EMLL+HPF+ GL D+ Sbjct: 242 ELIKRIGDRFELPVIPSEISQDGKDFLKRCLVKKPAFRFTSEMLLDHPFMSGLDDS 297 >ref|XP_002332066.1| predicted protein [Populus trichocarpa] gi|222831952|gb|EEE70429.1| predicted protein [Populus trichocarpa] Length = 282 Score = 70.1 bits (170), Expect = 2e-10 Identities = 33/62 (53%), Positives = 45/62 (72%) Frame = +3 Query: 3 DLEANDLLERIADGREMPKIPNEISIEAKNFLKGCLVRKPMYRLTAEMLLNHPFLEGLVD 182 D+ +L +I DG E+PK+P+E+S +AK+FLK C V PM+R TAEMLL+ PF+ G VD Sbjct: 222 DVTIEELKRKIGDGYELPKMPSEVSKDAKDFLKRCFVANPMFRFTAEMLLDEPFVSG-VD 280 Query: 183 AD 188 D Sbjct: 281 LD 282 >ref|XP_002303860.1| predicted protein [Populus trichocarpa] gi|222841292|gb|EEE78839.1| predicted protein [Populus trichocarpa] Length = 278 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/50 (60%), Positives = 40/50 (80%) Frame = +3 Query: 18 DLLERIADGREMPKIPNEISIEAKNFLKGCLVRKPMYRLTAEMLLNHPFL 167 +LL +I DG E+PKIP++IS +AK+FLK C V PM+R TAEMLL+ PF+ Sbjct: 229 ELLRKIGDGYELPKIPSQISKDAKDFLKRCFVANPMFRFTAEMLLDEPFM 278 >ref|XP_002513021.1| ATP binding protein, putative [Ricinus communis] gi|223548032|gb|EEF49524.1| ATP binding protein, putative [Ricinus communis] Length = 343 Score = 67.4 bits (163), Expect = 1e-09 Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 6/94 (6%) Frame = +3 Query: 3 DLEANDLLERIADGREMPKIPNEISIEAKNFLKGCLVRKPMYRLTAEMLLNHPFLEGLVD 182 D +++L++ I D ++P+IP +I + + FLK CLV+ PM+RLTA+MLLN PF+ GL D Sbjct: 222 DTTSDELIKSIGDRHQLPEIPYDIPEDGRAFLKKCLVKNPMFRLTADMLLNEPFVSGLRD 281 Query: 183 ------ADXXXXXXXXXSDVNADSSLMLLSEADY 266 A+ D + L +S+ DY Sbjct: 282 DKCSDIAENSVEGQRRSCDSSRSKDLDFISKEDY 315