BLASTX nr result
ID: Bupleurum21_contig00031968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00031968 (804 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB76813.1| tonoplast intrinsic protein [Olea europaea] 58 3e-06 >gb|ABB76813.1| tonoplast intrinsic protein [Olea europaea] Length = 252 Score = 57.8 bits (138), Expect = 3e-06 Identities = 31/61 (50%), Positives = 40/61 (65%) Frame = +1 Query: 19 AHVFAIFSAVFVDGNISGGHVDPSLCLVPSFIGGHITFFRSINCLLDCPMPRLCCCLLAC 198 AH FA+F AV V NISGGHV+P++ L +F+GGHIT FRSI + + + CLL Sbjct: 64 AHAFALFVAVSVGANISGGHVNPAVTL-GAFVGGHITLFRSIMYWIAQLLGSVIACLLLK 122 Query: 199 F 201 F Sbjct: 123 F 123