BLASTX nr result
ID: Bupleurum21_contig00031903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00031903 (466 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002429204.1| zinc finger and cchc domain-containing prote... 54 1e-05 >ref|XP_002429204.1| zinc finger and cchc domain-containing protein, putative [Pediculus humanus corporis] gi|212514093|gb|EEB16466.1| zinc finger and cchc domain-containing protein, putative [Pediculus humanus corporis] Length = 709 Score = 54.3 bits (129), Expect = 1e-05 Identities = 48/156 (30%), Positives = 77/156 (49%), Gaps = 4/156 (2%) Frame = +3 Query: 6 LLILKHKPSGIDVDLTLNKFETAYIAKFIEYSISAHPLVKMLILTVKKWLKDQEVKKSML 185 +LIL +G+ D++ + ++ I++ S VK ++L VK W+KD KKS+L Sbjct: 470 ILILTEISTGLQCDISFKNGLSVNNSRLIKFFTSLDERVKPIMLFVKYWIKDYG-KKSIL 528 Query: 186 PSVSPALMCIAYLQERKKLPVLPT----EEMDCSKLNSKGSKGEFYDDALEIYKDAIKQS 353 S + LM + YLQ R P+LPT E+ K N+ +DD + Y IK S Sbjct: 529 SSFALTLMVVFYLQ-RLSQPILPTVDELEKKFVGKRNTVAGWNCDFDDNIVNYVYRIKNS 587 Query: 354 KAENPFNNLSIGEIVHDFFIHYSRIHNFKKDVISVL 461 + L + + +F+IH+ N+ + VIS L Sbjct: 588 NSV-----LDLIKGFFEFYIHF----NYDEYVISPL 614