BLASTX nr result
ID: Bupleurum21_contig00031902
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00031902 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265299.1| PREDICTED: uncharacterized protein LOC100264... 57 2e-06 ref|XP_002306402.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|NP_187893.1| uncharacterized protein [Arabidopsis thaliana] ... 55 4e-06 ref|XP_002884931.1| hypothetical protein ARALYDRAFT_897496 [Arab... 54 1e-05 >ref|XP_002265299.1| PREDICTED: uncharacterized protein LOC100264983 [Vitis vinifera] Length = 202 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 311 VKKWEARDFVTLFFISVSCLVLGLVRVILCS 219 V+KW ARDFVT FF +VSCLVLGLVRVILC+ Sbjct: 172 VRKWSARDFVTFFFFTVSCLVLGLVRVILCN 202 >ref|XP_002306402.1| predicted protein [Populus trichocarpa] gi|222855851|gb|EEE93398.1| predicted protein [Populus trichocarpa] Length = 196 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -1 Query: 311 VKKWEARDFVTLFFISVSCLVLGLVRVILCS 219 V+KW RDFVTLFF SVSCLVLGL R+ILC+ Sbjct: 166 VRKWSTRDFVTLFFFSVSCLVLGLTRIILCN 196 >ref|NP_187893.1| uncharacterized protein [Arabidopsis thaliana] gi|6997162|gb|AAF34826.1| hypothetical protein [Arabidopsis thaliana] gi|9279771|dbj|BAB01416.1| unnamed protein product [Arabidopsis thaliana] gi|149944345|gb|ABR46215.1| At3g12870 [Arabidopsis thaliana] gi|332641734|gb|AEE75255.1| uncharacterized protein [Arabidopsis thaliana] Length = 206 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 311 VKKWEARDFVTLFFISVSCLVLGLVRVILC 222 VKKW ARDFVTLFF SVSCLVL ++R+ILC Sbjct: 176 VKKWSARDFVTLFFFSVSCLVLAMIRLILC 205 >ref|XP_002884931.1| hypothetical protein ARALYDRAFT_897496 [Arabidopsis lyrata subsp. lyrata] gi|297330771|gb|EFH61190.1| hypothetical protein ARALYDRAFT_897496 [Arabidopsis lyrata subsp. lyrata] Length = 208 Score = 54.3 bits (129), Expect = 1e-05 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 311 VKKWEARDFVTLFFISVSCLVLGLVRVILC 222 V+KW ARDFVTLFF SVSCLVL ++R+ILC Sbjct: 178 VRKWSARDFVTLFFFSVSCLVLAMIRLILC 207