BLASTX nr result
ID: Bupleurum21_contig00031863
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00031863 (252 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517233.1| ankyrin repeat-containing protein, putative ... 56 3e-06 >ref|XP_002517233.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223543604|gb|EEF45133.1| ankyrin repeat-containing protein, putative [Ricinus communis] Length = 580 Score = 56.2 bits (134), Expect = 3e-06 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%) Frame = +3 Query: 9 KVKHMQAKELANLICSRVINMVNHEKAWYVMGAALPIAVEHGTVEIIEQCIYHYPGLVWY 188 K+ H+QA EL +C + + E + A+ AV+HGTVE +E+ HYP ++W Sbjct: 242 KLTHVQAHELLCCLCQEISTLHKSEFENIGVYRAIFKAVKHGTVEFVEEMTKHYPDIIWC 301 Query: 189 HVDEFQ--LFRAAIIHRQEKVYN 251 DE +F A++ RQEKV+N Sbjct: 302 E-DECNRGIFMYAVLQRQEKVFN 323