BLASTX nr result
ID: Bupleurum21_contig00031469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00031469 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317794.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 >ref|XP_002317794.1| predicted protein [Populus trichocarpa] gi|222858467|gb|EEE96014.1| predicted protein [Populus trichocarpa] Length = 852 Score = 54.7 bits (130), Expect = 8e-06 Identities = 33/92 (35%), Positives = 47/92 (51%), Gaps = 9/92 (9%) Frame = +1 Query: 34 LSLYANHICFKDAHLLLSSLDQP---------PIFNMTCSGLLLGKVGQQLHGFVSAFEL 186 LS+Y +H F++A LL L P+ CSGL ++G+QLHG V F Sbjct: 132 LSVYLDHGLFEEAFLLFQVLQFDGVELDFFVFPLVFKACSGLGSVELGRQLHGLVIKFRF 191 Query: 187 ASDCIVQSSFVHFYVKCCQLSNARKVLDVMPE 282 + V ++ + Y KC L +A+KVL MPE Sbjct: 192 CLNIYVSNALIDMYGKCGSLDDAKKVLVKMPE 223