BLASTX nr result
ID: Bupleurum21_contig00031251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00031251 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540196.1| PREDICTED: ABC transporter G family member 3... 73 2e-11 ref|XP_002523691.1| ATP-binding cassette transporter, putative [... 73 2e-11 ref|XP_004161314.1| PREDICTED: ABC transporter G family member 3... 72 6e-11 ref|XP_004147284.1| PREDICTED: ABC transporter G family member 3... 72 6e-11 ref|XP_003543454.1| PREDICTED: ABC transporter G family member 3... 72 6e-11 >ref|XP_003540196.1| PREDICTED: ABC transporter G family member 3-like [Glycine max] Length = 724 Score = 73.2 bits (178), Expect = 2e-11 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -1 Query: 111 FFYLRKPGSLGHPISFEDSPDWDDTDVEVRMEEGGDS 1 FFYLRKPGSL HPISFEDSP+W+DTD++ R+EEGGDS Sbjct: 30 FFYLRKPGSLRHPISFEDSPEWEDTDIDARVEEGGDS 66 >ref|XP_002523691.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223536995|gb|EEF38631.1| ATP-binding cassette transporter, putative [Ricinus communis] Length = 722 Score = 73.2 bits (178), Expect = 2e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -1 Query: 111 FFYLRKPGSLGHPISFEDSPDWDDTDVEVRMEEGGDS 1 FFYLRKPGSL PISFEDSP+W+DTD++VRMEEGGDS Sbjct: 30 FFYLRKPGSLRQPISFEDSPEWEDTDIDVRMEEGGDS 66 >ref|XP_004161314.1| PREDICTED: ABC transporter G family member 3-like [Cucumis sativus] Length = 721 Score = 71.6 bits (174), Expect = 6e-11 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -1 Query: 111 FFYLRKPGSLGHPISFEDSPDWDDTDVEVRMEEGGDS 1 FFYLRKPGSL PISFEDSPDW++TD++VR+EEGGDS Sbjct: 30 FFYLRKPGSLRQPISFEDSPDWEETDIDVRIEEGGDS 66 >ref|XP_004147284.1| PREDICTED: ABC transporter G family member 3-like [Cucumis sativus] Length = 721 Score = 71.6 bits (174), Expect = 6e-11 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -1 Query: 111 FFYLRKPGSLGHPISFEDSPDWDDTDVEVRMEEGGDS 1 FFYLRKPGSL PISFEDSPDW++TD++VR+EEGGDS Sbjct: 30 FFYLRKPGSLRQPISFEDSPDWEETDIDVRIEEGGDS 66 >ref|XP_003543454.1| PREDICTED: ABC transporter G family member 3-like [Glycine max] Length = 724 Score = 71.6 bits (174), Expect = 6e-11 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -1 Query: 111 FFYLRKPGSLGHPISFEDSPDWDDTDVEVRMEEGGDS 1 FFYLRKPGSL PISFEDSP+W+DTD++VR+EEGGDS Sbjct: 30 FFYLRKPGSLRQPISFEDSPEWEDTDIDVRVEEGGDS 66