BLASTX nr result
ID: Bupleurum21_contig00031225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00031225 (262 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324965.1| predicted protein [Populus trichocarpa] gi|2... 44 8e-07 >ref|XP_002324965.1| predicted protein [Populus trichocarpa] gi|222866399|gb|EEF03530.1| predicted protein [Populus trichocarpa] Length = 705 Score = 43.5 bits (101), Expect(2) = 8e-07 Identities = 21/31 (67%), Positives = 26/31 (83%), Gaps = 1/31 (3%) Frame = -2 Query: 261 SLSDKDTNLILTNRLQIGQFVYV-RLRFSCP 172 SLS++DT+LILTNRLQ+GQFVY+ R F P Sbjct: 65 SLSERDTDLILTNRLQLGQFVYIDRFDFDSP 95 Score = 34.3 bits (77), Expect(2) = 8e-07 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 194 FDFDSPVPRASDVRPIA 144 FDFDSPVPR S +RPIA Sbjct: 90 FDFDSPVPRVSGIRPIA 106