BLASTX nr result
ID: Bupleurum21_contig00031049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00031049 (355 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAS92255.1| putative pyridoxine biosynthesis protein isoform ... 63 3e-08 ref|XP_003593782.1| Pyridoxal biosynthesis protein PDX1.3 [Medic... 61 8e-08 ref|XP_004137720.1| PREDICTED: probable pyridoxal biosynthesis p... 61 1e-07 sp|Q9FT25.1|PDX1_PHAVU RecName: Full=Pyridoxal biosynthesis prot... 60 1e-07 gb|AAZ67141.1| pyridoxine biosynthesis protein [Lotus japonicus] 60 2e-07 >gb|AAS92255.1| putative pyridoxine biosynthesis protein isoform A [Nicotiana tabacum] gi|46399271|gb|AAS92256.1| putative pyridoxine biosynthesis protein isoform B [Nicotiana tabacum] Length = 309 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 353 SDPELLAEISCGLGEAMVGLNLDKNVERYANRSE 252 SDP LLAEISCGLGEAMVG+NLD VERYANRSE Sbjct: 276 SDPGLLAEISCGLGEAMVGINLDDKVERYANRSE 309 >ref|XP_003593782.1| Pyridoxal biosynthesis protein PDX1.3 [Medicago truncatula] gi|72256515|gb|AAZ67140.1| pyridoxine biosynthesis protein [Medicago truncatula] gi|355482830|gb|AES64033.1| Pyridoxal biosynthesis protein PDX1.3 [Medicago truncatula] Length = 314 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/35 (85%), Positives = 33/35 (94%), Gaps = 1/35 (2%) Frame = -3 Query: 353 SDPELLAEISCGLGEAMVGLNL-DKNVERYANRSE 252 SDPE+LAE+SCGLGEAMVGLNL D NVER+ANRSE Sbjct: 280 SDPEILAEVSCGLGEAMVGLNLTDHNVERFANRSE 314 >ref|XP_004137720.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1-like [Cucumis sativus] gi|449523121|ref|XP_004168573.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1-like [Cucumis sativus] gi|307135934|gb|ADN33796.1| pyridoxal biosynthesis protein [Cucumis melo subsp. melo] Length = 308 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -3 Query: 353 SDPELLAEISCGLGEAMVGLNLDKNVERYANRSE 252 +DPE+LAE+SCGLGEAMVGLNL++ VER+ANRSE Sbjct: 275 NDPEVLAEVSCGLGEAMVGLNLNEKVERFANRSE 308 >sp|Q9FT25.1|PDX1_PHAVU RecName: Full=Pyridoxal biosynthesis protein PDX1; AltName: Full=pvPDX1 gi|10719739|gb|AAG17942.1| putative pyridoxine biosynthetic enzyme [Phaseolus vulgaris] Length = 312 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/35 (82%), Positives = 33/35 (94%), Gaps = 1/35 (2%) Frame = -3 Query: 353 SDPELLAEISCGLGEAMVGLNL-DKNVERYANRSE 252 SDPE+LAE+SCGLGEAMVG+NL D NVER+ANRSE Sbjct: 278 SDPEILAEVSCGLGEAMVGINLSDTNVERFANRSE 312 >gb|AAZ67141.1| pyridoxine biosynthesis protein [Lotus japonicus] Length = 310 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/35 (88%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = -3 Query: 353 SDPELLAEISCGLGEAMVGLNL-DKNVERYANRSE 252 SDP LLAEISCGLGEAMVGLNL D NVER+ANRSE Sbjct: 276 SDPGLLAEISCGLGEAMVGLNLNDSNVERFANRSE 310