BLASTX nr result
ID: Bupleurum21_contig00031033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00031033 (348 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521829.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 ref|XP_002330422.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 ref|XP_002316934.1| cyclic nucleotide-gated channel [Populus tri... 60 1e-07 emb|CBI20378.3| unnamed protein product [Vitis vinifera] 58 9e-07 ref|XP_003526202.1| PREDICTED: uncharacterized protein LOC100797... 57 2e-06 >ref|XP_002521829.1| conserved hypothetical protein [Ricinus communis] gi|223539042|gb|EEF40639.1| conserved hypothetical protein [Ricinus communis] Length = 373 Score = 63.5 bits (153), Expect = 2e-08 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = -1 Query: 132 HWSFLDEIEAPMWVDLSSEVTGTSHENDDEWFLMTHQYHQCSS 4 HW+FLDEIEAPMWVDL+ E + DD WF +H +HQCSS Sbjct: 14 HWAFLDEIEAPMWVDLTLEANSNYTDVDDGWFHTSHLFHQCSS 56 >ref|XP_002330422.1| predicted protein [Populus trichocarpa] gi|222871807|gb|EEF08938.1| predicted protein [Populus trichocarpa] Length = 490 Score = 61.6 bits (148), Expect = 6e-08 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = -1 Query: 132 HWSFLDEIEAPMWVDLSSEVTGTSHENDDEWFLMTHQYHQCSS 4 HW+FL+EIEAP+WVD E + DDEWF +H +HQCSS Sbjct: 10 HWAFLEEIEAPIWVDFLVEAKSNYQDVDDEWFRTSHPFHQCSS 52 >ref|XP_002316934.1| cyclic nucleotide-gated channel [Populus trichocarpa] gi|222859999|gb|EEE97546.1| cyclic nucleotide-gated channel [Populus trichocarpa] Length = 565 Score = 60.5 bits (145), Expect = 1e-07 Identities = 23/43 (53%), Positives = 31/43 (72%) Frame = -1 Query: 132 HWSFLDEIEAPMWVDLSSEVTGTSHENDDEWFLMTHQYHQCSS 4 HW+FL+EIEAPMWVD + E + DD+WF +H +HQC+S Sbjct: 10 HWAFLEEIEAPMWVDFTIEEKSNYQDVDDKWFHTSHPFHQCTS 52 >emb|CBI20378.3| unnamed protein product [Vitis vinifera] Length = 455 Score = 57.8 bits (138), Expect = 9e-07 Identities = 22/43 (51%), Positives = 31/43 (72%) Frame = -1 Query: 132 HWSFLDEIEAPMWVDLSSEVTGTSHENDDEWFLMTHQYHQCSS 4 HW+FL+E EAPMW DL+ E + + DD+WF ++H +HQ SS Sbjct: 9 HWAFLEEFEAPMWADLTLEAKTNNQDVDDKWFHISHPFHQFSS 51 >ref|XP_003526202.1| PREDICTED: uncharacterized protein LOC100797287 [Glycine max] Length = 388 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/44 (56%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -1 Query: 129 WSFLDEIEAPMWVDLSSEV-TGTSHENDDEWFLMTHQYHQCSSR 1 W+FL+ IEAPMWVDL+ EV +G DDEWF +H +HQ S+R Sbjct: 18 WAFLEHIEAPMWVDLTLEVKSGCVDTGDDEWFNTSHPFHQMSAR 61