BLASTX nr result
ID: Bupleurum21_contig00030868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00030868 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19389.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_002283378.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_002301807.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 ref|XP_002883590.1| hypothetical protein ARALYDRAFT_899142 [Arab... 57 1e-06 ref|NP_189158.3| pentatricopeptide repeat-containing protein [Ar... 57 2e-06 >emb|CBI19389.3| unnamed protein product [Vitis vinifera] Length = 365 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = +3 Query: 183 NPNPKTWTPHEKQFETWLQNLKPGFTPADVELALRAQSD 299 +PNPKT TP + QFE+W+ LKPGF+P+DV+ ALRAQSD Sbjct: 63 SPNPKTPTPLQMQFESWIHMLKPGFSPSDVDEALRAQSD 101 >ref|XP_002283378.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Vitis vinifera] Length = 393 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = +3 Query: 183 NPNPKTWTPHEKQFETWLQNLKPGFTPADVELALRAQSD 299 +PNPKT TP + QFE+W+ LKPGF+P+DV+ ALRAQSD Sbjct: 63 SPNPKTPTPLQMQFESWIHMLKPGFSPSDVDEALRAQSD 101 >ref|XP_002301807.1| predicted protein [Populus trichocarpa] gi|222843533|gb|EEE81080.1| predicted protein [Populus trichocarpa] Length = 325 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 198 TWTPHEKQFETWLQNLKPGFTPADVELALRAQSD 299 T TP E QFETW QNLKPGFTP DV+ A+RAQSD Sbjct: 1 TRTPLETQFETWTQNLKPGFTPTDVDTAIRAQSD 34 >ref|XP_002883590.1| hypothetical protein ARALYDRAFT_899142 [Arabidopsis lyrata subsp. lyrata] gi|297329430|gb|EFH59849.1| hypothetical protein ARALYDRAFT_899142 [Arabidopsis lyrata subsp. lyrata] Length = 379 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = +3 Query: 186 PNPKTWTPHEKQFETWLQNLKPGFTPADVELALRAQSD 299 P +T TP E QFETW+QNLKPGFT +DV ALRAQSD Sbjct: 50 PRIRTRTPLETQFETWIQNLKPGFTNSDVVTALRAQSD 87 >ref|NP_189158.3| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75273968|sp|Q9LSF5.1|PP254_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g25210, mitochondrial; Flags: Precursor gi|9294178|dbj|BAB02080.1| unnamed protein product [Arabidopsis thaliana] gi|332643472|gb|AEE76993.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 379 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 195 KTWTPHEKQFETWLQNLKPGFTPADVELALRAQSD 299 +T TP E QFETW+QNLKPGFT +DV +ALRAQSD Sbjct: 53 RTRTPLETQFETWIQNLKPGFTNSDVVIALRAQSD 87