BLASTX nr result
ID: Bupleurum21_contig00030861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00030861 (508 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515332.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 ref|XP_002509827.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002515332.1| conserved hypothetical protein [Ricinus communis] gi|223545812|gb|EEF47316.1| conserved hypothetical protein [Ricinus communis] Length = 171 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = -3 Query: 152 LSFSPKIECPKFDGTNPRNWIDKCGRYFELCKVLDYQKVDIASLYMVGKA 3 L + PK++ PKFDG+N R WI KC +YF CK+ D QKVD+ASL MV KA Sbjct: 29 LGYIPKLKFPKFDGSNLRQWIKKCCKYFVFCKIPDKQKVDLASLNMVDKA 78 >ref|XP_002509827.1| conserved hypothetical protein [Ricinus communis] gi|223549726|gb|EEF51214.1| conserved hypothetical protein [Ricinus communis] Length = 208 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/46 (52%), Positives = 33/46 (71%) Frame = -3 Query: 140 PKIECPKFDGTNPRNWIDKCGRYFELCKVLDYQKVDIASLYMVGKA 3 PK+E F+G NPR WI KC +YF+L + + QK+DIASLY+ +A Sbjct: 109 PKVELSHFEGNNPRLWIKKCEKYFQLYSIPNEQKIDIASLYLGDRA 154