BLASTX nr result
ID: Bupleurum21_contig00030841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00030841 (605 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] g... 70 2e-10 ref|XP_002535311.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 >ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] gi|355477354|gb|AES58557.1| Ribosomal protein S3 [Medicago truncatula] Length = 306 Score = 70.5 bits (171), Expect = 2e-10 Identities = 38/58 (65%), Positives = 39/58 (67%) Frame = -3 Query: 183 MGQRIKRFYFVSRDTPQVGFESRVMGDYPARFGEHF*SALVNGSPPIKQEISGSSHGG 10 MGQRIKRF FVSRD+PQVGFESRVMGDYPARFGE SG SHGG Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE-----------------SGYSHGG 41 >ref|XP_002535311.1| conserved hypothetical protein [Ricinus communis] gi|223523476|gb|EEF27072.1| conserved hypothetical protein [Ricinus communis] Length = 63 Score = 59.7 bits (143), Expect = 4e-07 Identities = 38/61 (62%), Positives = 42/61 (68%), Gaps = 7/61 (11%) Frame = +2 Query: 212 SSDAARDKLSF*LLSFGSDKLSPFGRFAQ-------VVFPYLP*R*DSGLRKEPLPSALN 370 +SDAARD+LSF LSFGSDK SPFGRFAQ V FP + + SGLRKE PS LN Sbjct: 5 ASDAARDRLSFKPLSFGSDKSSPFGRFAQVRWSSRSVGFPNV--KSCSGLRKEHRPSTLN 62 Query: 371 E 373 E Sbjct: 63 E 63