BLASTX nr result
ID: Bupleurum21_contig00030808
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00030808 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279361.1| PREDICTED: UPF0202 protein At1g10490 [Vitis ... 63 2e-08 >ref|XP_002279361.1| PREDICTED: UPF0202 protein At1g10490 [Vitis vinifera] gi|296082521|emb|CBI21526.3| unnamed protein product [Vitis vinifera] Length = 1032 Score = 63.2 bits (152), Expect = 2e-08 Identities = 36/67 (53%), Positives = 48/67 (71%), Gaps = 9/67 (13%) Frame = -3 Query: 251 RYAIPDSE-NFESAVKNG--KIPASGLVSVKSSRSKDENHAKRKDSDK------KDKHGS 99 +YAI D E +FE A++NG K+P+SGL+SVKSSR+K E H K++ S K KD H S Sbjct: 965 QYAIADREADFEKALQNGGGKLPSSGLISVKSSRTKMEKHGKQEKSHKSGEKRSKDHHSS 1024 Query: 98 RSNKKKK 78 +SNKK+K Sbjct: 1025 KSNKKRK 1031