BLASTX nr result
ID: Bupleurum21_contig00030764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00030764 (585 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69191.1| hypothetical protein VITISV_001579 [Vitis vinifera] 57 2e-06 >emb|CAN69191.1| hypothetical protein VITISV_001579 [Vitis vinifera] Length = 188 Score = 57.4 bits (137), Expect = 2e-06 Identities = 32/87 (36%), Positives = 44/87 (50%) Frame = -3 Query: 571 IFGIAVPVLLTALQLKYQETTHSPFEDHPKAMAIVIVSFLILCLGCDTQQYFESTTTTRR 392 + +P+L+ L LKY E +PFE HPK M I S L+ CL TQ +S+ Sbjct: 40 VLAFILPLLVAFLALKYVEKVATPFETHPKTMQFAIGSLLVYCLAYGTQLSVQSSIYVNA 99 Query: 391 FATLVLFQHGLRLTGYISLASLASVIF 311 F + L G +S+ASLAS+ F Sbjct: 100 FGRF------MELFGSLSMASLASIFF 120