BLASTX nr result
ID: Bupleurum21_contig00030739
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00030739 (406 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003608003.1| hypothetical protein MTR_4g086440 [Medicago ... 62 5e-08 ref|XP_002519241.1| conserved hypothetical protein [Ricinus comm... 61 8e-08 ref|XP_002282404.2| PREDICTED: probable ubiquitin-conjugating en... 61 1e-07 emb|CBI20306.3| unnamed protein product [Vitis vinifera] 61 1e-07 ref|XP_002519240.1| ubiquitin conjugating enzyme, putative [Rici... 61 1e-07 >ref|XP_003608003.1| hypothetical protein MTR_4g086440 [Medicago truncatula] gi|355509058|gb|AES90200.1| hypothetical protein MTR_4g086440 [Medicago truncatula] Length = 319 Score = 62.0 bits (149), Expect = 5e-08 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = +2 Query: 2 NYPNQPPLVHYKSFGHCINPNLYSYGFVCLSILNTWSAS 118 +YPN PP +HY SFG+ +NPNLY G VCLS+LNTW ++ Sbjct: 92 DYPNSPPKIHYHSFGYSLNPNLYPDGTVCLSLLNTWPST 130 >ref|XP_002519241.1| conserved hypothetical protein [Ricinus communis] gi|223541556|gb|EEF43105.1| conserved hypothetical protein [Ricinus communis] Length = 362 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/52 (55%), Positives = 38/52 (73%), Gaps = 4/52 (7%) Frame = +2 Query: 2 NYPNQPPLVHYKSFGHCINPNLYSYGFVCLSILNTW----SASVLPNQNVTL 145 +YP++PPLV+YKSFG INPNLY+ G VCLS++NTW S PN++ L Sbjct: 118 DYPSRPPLVYYKSFGLRINPNLYANGRVCLSLVNTWHGKKSEKWNPNESTVL 169 >ref|XP_002282404.2| PREDICTED: probable ubiquitin-conjugating enzyme E2 24-like [Vitis vinifera] Length = 750 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +2 Query: 2 NYPNQPPLVHYKSFGHCINPNLYSYGFVCLSILNTWS 112 +YPN PPLVHY+S G +NPNLY G VCLS+LNTWS Sbjct: 533 DYPNAPPLVHYRSGGLRLNPNLYDNGKVCLSLLNTWS 569 >emb|CBI20306.3| unnamed protein product [Vitis vinifera] Length = 497 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +2 Query: 2 NYPNQPPLVHYKSFGHCINPNLYSYGFVCLSILNTWS 112 +YPN PPLVHY+S G +NPNLY G VCLS+LNTWS Sbjct: 280 DYPNAPPLVHYRSGGLRLNPNLYDNGKVCLSLLNTWS 316 >ref|XP_002519240.1| ubiquitin conjugating enzyme, putative [Ricinus communis] gi|223541555|gb|EEF43104.1| ubiquitin conjugating enzyme, putative [Ricinus communis] Length = 281 Score = 60.8 bits (146), Expect = 1e-07 Identities = 23/36 (63%), Positives = 32/36 (88%) Frame = +2 Query: 2 NYPNQPPLVHYKSFGHCINPNLYSYGFVCLSILNTW 109 NYP++PP V+Y+S G +NPNLY++G+VCLS+LNTW Sbjct: 97 NYPDEPPSVYYRSHGLNLNPNLYAHGYVCLSLLNTW 132