BLASTX nr result
ID: Bupleurum21_contig00030684
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00030684 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615596.1| Zinc finger MYM-type protein [Medicago trunc... 57 1e-06 ref|XP_003536992.1| PREDICTED: uncharacterized protein LOC100819... 57 2e-06 gb|ABA93603.1| hAT family dimerisation domain containing protein... 55 4e-06 gb|AAL86479.1|AC077693_18 putative transposase [Oryza sativa Jap... 55 4e-06 emb|CAH65987.1| H1005F08.16 [Oryza sativa Indica Group] 55 4e-06 >ref|XP_003615596.1| Zinc finger MYM-type protein [Medicago truncatula] gi|355516931|gb|AES98554.1| Zinc finger MYM-type protein [Medicago truncatula] Length = 892 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/45 (53%), Positives = 34/45 (75%) Frame = +3 Query: 9 SDVRNSIGDELLNDCLICFIERDLASNISNDAIVHRFQSMKTRRG 143 S +RN +GD+ +NDCL+ +IERD+A I ++ I+ RFQ M TRRG Sbjct: 846 SRLRNRMGDDWMNDCLVTYIERDVADKIDDELIIQRFQKMATRRG 890 >ref|XP_003536992.1| PREDICTED: uncharacterized protein LOC100819269 [Glycine max] Length = 557 Score = 57.0 bits (136), Expect = 2e-06 Identities = 22/45 (48%), Positives = 36/45 (80%) Frame = +3 Query: 15 VRNSIGDELLNDCLICFIERDLASNISNDAIVHRFQSMKTRRGKV 149 +RN +GD +NDCL+ +IE+D+ + I N+ I+ RFQ+MK+RRG++ Sbjct: 513 LRNRLGDAWMNDCLVTYIEKDMFNKIDNERIIQRFQNMKSRRGQL 557 >gb|ABA93603.1| hAT family dimerisation domain containing protein [Oryza sativa Japonica Group] Length = 876 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/47 (51%), Positives = 34/47 (72%) Frame = +3 Query: 15 VRNSIGDELLNDCLICFIERDLASNISNDAIVHRFQSMKTRRGKV*E 155 VRNS+ D+LLN+CL+ IERD+ SN+ + I+H F +MK R+ K E Sbjct: 829 VRNSMSDKLLNNCLVTLIERDIFSNVREEDIIHSFMTMKKRKAKALE 875 >gb|AAL86479.1|AC077693_18 putative transposase [Oryza sativa Japonica Group] Length = 811 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = +3 Query: 9 SDVRNSIGDELLNDCLICFIERDLASNISNDAIVHRFQSMKTRR 140 S +RNS+ D+LLNDCLI FIERD+ S +S + I F SMKTRR Sbjct: 764 SKLRNSMCDKLLNDCLITFIERDVFSQVSEEDIKKNFMSMKTRR 807 >emb|CAH65987.1| H1005F08.16 [Oryza sativa Indica Group] Length = 864 Score = 55.5 bits (132), Expect = 4e-06 Identities = 23/45 (51%), Positives = 35/45 (77%) Frame = +3 Query: 15 VRNSIGDELLNDCLICFIERDLASNISNDAIVHRFQSMKTRRGKV 149 +RN +G++ LNDCL+ F+ERDL ++ND I+ RFQ+M TR+ K+ Sbjct: 820 LRNRMGEQYLNDCLVTFLERDLFVQVTNDDIISRFQAMATRKVKL 864