BLASTX nr result
ID: Bupleurum21_contig00030672
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00030672 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280894.2| PREDICTED: NAC domain-containing protein 68-... 57 1e-06 emb|CAN78113.1| hypothetical protein VITISV_004432 [Vitis vinifera] 57 1e-06 >ref|XP_002280894.2| PREDICTED: NAC domain-containing protein 68-like [Vitis vinifera] gi|297742117|emb|CBI33904.3| unnamed protein product [Vitis vinifera] Length = 365 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = -1 Query: 290 SYSNFTEKIELADDLNQFGCMSPYSGHVDYSSFFGNESMP 171 SYSNF ++E ADD ++ GCMSPYSG +Y F+GNE +P Sbjct: 289 SYSNFPGEVEFADDFSRIGCMSPYSGDPNYMGFYGNEDVP 328 >emb|CAN78113.1| hypothetical protein VITISV_004432 [Vitis vinifera] Length = 365 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = -1 Query: 290 SYSNFTEKIELADDLNQFGCMSPYSGHVDYSSFFGNESMP 171 SYSNF ++E ADD ++ GCMSPYSG +Y F+GNE +P Sbjct: 289 SYSNFPGEVEFADDFSRIGCMSPYSGDPNYMGFYGNEDVP 328