BLASTX nr result
ID: Bupleurum21_contig00030606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00030606 (339 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268526.2| PREDICTED: pentatricopeptide repeat-containi... 61 1e-17 ref|XP_002518061.1| pentatricopeptide repeat-containing protein,... 51 2e-13 ref|XP_002866485.1| pentatricopeptide repeat-containing protein ... 44 2e-08 ref|XP_002328242.1| predicted protein [Populus trichocarpa] gi|2... 46 3e-08 ref|NP_201043.1| pentatricopeptide repeat-containing protein [Ar... 45 3e-08 >ref|XP_002268526.2| PREDICTED: pentatricopeptide repeat-containing protein At5g62370-like [Vitis vinifera] Length = 1101 Score = 61.2 bits (147), Expect(2) = 1e-17 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Frame = +3 Query: 111 SHNA*KR-ISPSEASYEKLLNCFCSCGLSSNAFKIFVDMLAHGYKPCCYTLNQLFVMFIE 287 SH KR + P+++SYEKLL C C+ L +AFKIF +ML+H Y PC Y N L + E Sbjct: 898 SHTMHKRGLFPNKSSYEKLLKCLCASHLGVHAFKIFEEMLSHDYVPCWYNCNWLLCILCE 957 Query: 288 DNK 296 +++ Sbjct: 958 EHR 960 Score = 53.1 bits (126), Expect(2) = 1e-17 Identities = 26/44 (59%), Positives = 31/44 (70%) Frame = +1 Query: 1 LYNKICADGFVPDKTMYNTMIKGLCVAKRPFDALALSVTMLKRG 132 L+NK+ ADG PD YN +IKGLC A R DAL++S TM KRG Sbjct: 862 LFNKMNADGLAPDGITYNALIKGLCKAGRLLDALSVSHTMHKRG 905 >ref|XP_002518061.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542657|gb|EEF44194.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 403 Score = 51.2 bits (121), Expect(2) = 2e-13 Identities = 23/45 (51%), Positives = 32/45 (71%) Frame = +1 Query: 1 LYNKICADGFVPDKTMYNTMIKGLCVAKRPFDALALSVTMLKRGY 135 L+N + A+ + PDK Y+T++KGLC A R DAL+L TM KRG+ Sbjct: 263 LFNLMNANAYSPDKVTYSTLLKGLCKASREIDALSLFFTMHKRGF 307 Score = 49.3 bits (116), Expect(2) = 2e-13 Identities = 24/53 (45%), Positives = 33/53 (62%) Frame = +3 Query: 138 PSEASYEKLLNCFCSCGLSSNAFKIFVDMLAHGYKPCCYTLNQLFVMFIEDNK 296 P++ASYE L+ FC+ LS AFK+F +MLAH Y P YT L + E+ + Sbjct: 309 PNKASYENLIRLFCARHLSIPAFKLFEEMLAHNYLPRQYTAEWLLHILHEEER 361 >ref|XP_002866485.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297312320|gb|EFH42744.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 983 Score = 43.9 bits (102), Expect(2) = 2e-08 Identities = 20/36 (55%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = +1 Query: 34 PDKTMYNTMIKGLCVAKRPFDALALSVTMLKRG-YP 138 PD+ M +T++KGLC ++RP DALAL + M K+G YP Sbjct: 860 PDQVMCSTLLKGLCESERPLDALALMLEMQKKGIYP 895 Score = 39.7 bits (91), Expect(2) = 2e-08 Identities = 22/57 (38%), Positives = 28/57 (49%) Frame = +3 Query: 126 KRISPSEASYEKLLNCFCSCGLSSNAFKIFVDMLAHGYKPCCYTLNQLFVMFIEDNK 296 K I P++ SYEKLL C C L+ AFK+ DM A P L + E+ K Sbjct: 891 KGIYPNKDSYEKLLQCLCYSRLTMEAFKVVKDMAALDIWPRSINHTWLIYILCEEKK 947 >ref|XP_002328242.1| predicted protein [Populus trichocarpa] gi|222837757|gb|EEE76122.1| predicted protein [Populus trichocarpa] Length = 893 Score = 45.8 bits (107), Expect(2) = 3e-08 Identities = 24/51 (47%), Positives = 34/51 (66%), Gaps = 1/51 (1%) Frame = +1 Query: 1 LYNKICADGF-VPDKTMYNTMIKGLCVAKRPFDALALSVTMLKRGYPLQRL 150 L+N++ ADG PD+ YNT++K LC + R DAL+L T+ KRG+ RL Sbjct: 742 LFNRMNADGCSTPDRCTYNTLLKSLCRSGRELDALSLVHTISKRGFFPNRL 792 Score = 37.0 bits (84), Expect(2) = 3e-08 Identities = 19/53 (35%), Positives = 29/53 (54%) Frame = +3 Query: 138 PSEASYEKLLNCFCSCGLSSNAFKIFVDMLAHGYKPCCYTLNQLFVMFIEDNK 296 P+ +YEK + FC+ +S AF+IF +M+A P Y N L + E+ K Sbjct: 789 PNRLAYEKSHHYFCAGHMSIPAFRIFEEMVACNLVPGLYRRNLLLYILCEEKK 841 >ref|NP_201043.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75180621|sp|Q9LVA2.1|PP443_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g62370 gi|8809650|dbj|BAA97201.1| unnamed protein product [Arabidopsis thaliana] gi|332010218|gb|AED97601.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 982 Score = 45.4 bits (106), Expect(2) = 3e-08 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = +1 Query: 34 PDKTMYNTMIKGLCVAKRPFDALALSVTMLKRG 132 PD+ MY+T++KGLC KRP DALAL + M K G Sbjct: 859 PDQVMYSTLLKGLCDFKRPLDALALMLEMQKSG 891 Score = 37.0 bits (84), Expect(2) = 3e-08 Identities = 20/55 (36%), Positives = 27/55 (49%) Frame = +3 Query: 132 ISPSEASYEKLLNCFCSCGLSSNAFKIFVDMLAHGYKPCCYTLNQLFVMFIEDNK 296 I+P++ SYEKLL C C L+ A K+ DM A P L + E+ K Sbjct: 892 INPNKDSYEKLLQCLCYSRLTMEAVKVVKDMAALDIWPRSINHTWLIYILCEEKK 946