BLASTX nr result
ID: Bupleurum21_contig00030500
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00030500 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU25595.1| pentatricopeptide repeat-containing protein [Stac... 57 1e-06 gb|ACU25596.1| pentatricopeptide repeat-containing protein [Stac... 57 2e-06 >gb|ACU25595.1| pentatricopeptide repeat-containing protein [Stachytarpheta cayennensis] Length = 418 Score = 57.4 bits (137), Expect = 1e-06 Identities = 32/101 (31%), Positives = 53/101 (52%), Gaps = 3/101 (2%) Frame = +3 Query: 15 LSIDVSDYVIYMCKYCGVGEIKKV---FERVLMGGKVLKRQSYVALIGALCRENEGGLGK 185 LS D+ Y + C GE+K+V + ++M G + SY LI C+E + + Sbjct: 272 LSPDLITYNTLIYGLCKKGELKQVHDLIDEMIMNGLKPDKISYTTLIDGSCKEGDLEIAL 331 Query: 186 EVANVMHGLGLRVDDFSYYVLFRCFCRNGDVNEADVILRKL 308 E+ N M +R+DD +Y L C CR G ++A+ +LR++ Sbjct: 332 ELRNKMIQESIRLDDVAYTALISCLCREGRASDAEKMLREM 372 >gb|ACU25596.1| pentatricopeptide repeat-containing protein [Stachytarpheta cayennensis] Length = 418 Score = 57.0 bits (136), Expect = 2e-06 Identities = 32/101 (31%), Positives = 52/101 (51%), Gaps = 3/101 (2%) Frame = +3 Query: 15 LSIDVSDYVIYMCKYCGVGEIKKV---FERVLMGGKVLKRQSYVALIGALCRENEGGLGK 185 LS D+ Y + C GE+K+V + ++M G + SY LI C+E + + Sbjct: 272 LSPDLITYNTLIYGLCKKGELKQVHDLIDEMIMNGLKPDKISYTTLIDGSCKEGDLEIAL 331 Query: 186 EVANVMHGLGLRVDDFSYYVLFRCFCRNGDVNEADVILRKL 308 E+ N M +R+DD +Y L C CR G +A+ +LR++ Sbjct: 332 ELRNKMIQESIRLDDVAYTALISCLCREGRAGDAEKMLREM 372