BLASTX nr result
ID: Bupleurum21_contig00030066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00030066 (457 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002331832.1| predicted protein [Populus trichocarpa] gi|2... 72 6e-11 ref|XP_002318357.1| predicted protein [Populus trichocarpa] gi|2... 72 6e-11 ref|XP_004156439.1| PREDICTED: probable pre-mRNA-splicing factor... 71 8e-11 ref|XP_004139208.1| PREDICTED: uncharacterized protein LOC101216... 71 8e-11 gb|ADN33898.1| ATP-dependent RNA helicase [Cucumis melo subsp. m... 71 8e-11 >ref|XP_002331832.1| predicted protein [Populus trichocarpa] gi|222875070|gb|EEF12201.1| predicted protein [Populus trichocarpa] Length = 1171 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -1 Query: 112 KLEYLSLVSKGCTELETHLGFGDKVLAEFITELGRNC 2 KLEYLSLVSK C+ELETHLGFGDK+LAEFITELGR+C Sbjct: 13 KLEYLSLVSKVCSELETHLGFGDKILAEFITELGRSC 49 >ref|XP_002318357.1| predicted protein [Populus trichocarpa] gi|222859030|gb|EEE96577.1| predicted protein [Populus trichocarpa] Length = 1207 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -1 Query: 112 KLEYLSLVSKGCTELETHLGFGDKVLAEFITELGRNC 2 KLEYLSLVSK C+ELETHLGFGDK+LAEFITELGR+C Sbjct: 13 KLEYLSLVSKVCSELETHLGFGDKILAEFITELGRSC 49 >ref|XP_004156439.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like [Cucumis sativus] Length = 1181 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -1 Query: 112 KLEYLSLVSKGCTELETHLGFGDKVLAEFITELGRNC 2 KLEYLSLVSK C+ELETHLGFGDKVLAEFITE+GR+C Sbjct: 8 KLEYLSLVSKVCSELETHLGFGDKVLAEFITEMGRSC 44 >ref|XP_004139208.1| PREDICTED: uncharacterized protein LOC101216792 [Cucumis sativus] Length = 1218 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -1 Query: 112 KLEYLSLVSKGCTELETHLGFGDKVLAEFITELGRNC 2 KLEYLSLVSK C+ELETHLGFGDKVLAEFITE+GR+C Sbjct: 14 KLEYLSLVSKVCSELETHLGFGDKVLAEFITEMGRSC 50 >gb|ADN33898.1| ATP-dependent RNA helicase [Cucumis melo subsp. melo] Length = 953 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -1 Query: 112 KLEYLSLVSKGCTELETHLGFGDKVLAEFITELGRNC 2 KLEYLSLVSK C+ELETHLGFGDKVLAEFITE+GR+C Sbjct: 14 KLEYLSLVSKVCSELETHLGFGDKVLAEFITEMGRSC 50