BLASTX nr result
ID: Bupleurum21_contig00030016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00030016 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003521542.1| PREDICTED: BTB/POZ domain-containing protein... 89 5e-16 emb|CAN74119.1| hypothetical protein VITISV_002050 [Vitis vinifera] 89 5e-16 ref|XP_002520669.1| protein binding protein, putative [Ricinus c... 88 6e-16 gb|ADV56692.1| NPH3 family protein [Phaseolus vulgaris] 88 8e-16 ref|XP_002320358.1| predicted protein [Populus trichocarpa] gi|2... 87 1e-15 >ref|XP_003521542.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like [Glycine max] Length = 629 Score = 88.6 bits (218), Expect = 5e-16 Identities = 41/62 (66%), Positives = 52/62 (83%) Frame = -1 Query: 188 PISDISSDLAVEVGTRTFPLHRLPLISRSGKIQKLLQEAKDAKFCRLTVTGVPGGAEAFE 9 PISD+SSDL +EVG TF LH+ PL+SRSG+I+KLL +AKD+K R+++ VPGGAEAFE Sbjct: 32 PISDVSSDLTIEVGASTFALHKFPLVSRSGRIRKLLLDAKDSKVLRISLPNVPGGAEAFE 91 Query: 8 LA 3 LA Sbjct: 92 LA 93 >emb|CAN74119.1| hypothetical protein VITISV_002050 [Vitis vinifera] Length = 1388 Score = 88.6 bits (218), Expect = 5e-16 Identities = 41/63 (65%), Positives = 51/63 (80%) Frame = -1 Query: 191 RPISDISSDLAVEVGTRTFPLHRLPLISRSGKIQKLLQEAKDAKFCRLTVTGVPGGAEAF 12 RPISD+SSDL +EVG +F LH+ PL+SRSG+I+KLL EAKD+K R+ + VPGG EAF Sbjct: 705 RPISDVSSDLTIEVGASSFALHKFPLVSRSGRIRKLLLEAKDSKVSRIAIPSVPGGPEAF 764 Query: 11 ELA 3 ELA Sbjct: 765 ELA 767 >ref|XP_002520669.1| protein binding protein, putative [Ricinus communis] gi|223540054|gb|EEF41631.1| protein binding protein, putative [Ricinus communis] Length = 631 Score = 88.2 bits (217), Expect = 6e-16 Identities = 41/62 (66%), Positives = 52/62 (83%) Frame = -1 Query: 188 PISDISSDLAVEVGTRTFPLHRLPLISRSGKIQKLLQEAKDAKFCRLTVTGVPGGAEAFE 9 PISD+SSDL VE+G +F LH+ PL+SRSG+I+KLL EAKD+K R+++ VPGGAEAFE Sbjct: 32 PISDVSSDLTVEIGASSFALHKFPLVSRSGRIRKLLLEAKDSKVSRISIACVPGGAEAFE 91 Query: 8 LA 3 LA Sbjct: 92 LA 93 >gb|ADV56692.1| NPH3 family protein [Phaseolus vulgaris] Length = 731 Score = 87.8 bits (216), Expect = 8e-16 Identities = 41/62 (66%), Positives = 51/62 (82%) Frame = -1 Query: 188 PISDISSDLAVEVGTRTFPLHRLPLISRSGKIQKLLQEAKDAKFCRLTVTGVPGGAEAFE 9 PISD+SSDL +EVG F LH+ PL+SRSG+I+KLL EAKD+K R+++ VPGGAEAFE Sbjct: 136 PISDVSSDLTIEVGASAFALHKFPLVSRSGRIRKLLLEAKDSKVLRISLPNVPGGAEAFE 195 Query: 8 LA 3 LA Sbjct: 196 LA 197 >ref|XP_002320358.1| predicted protein [Populus trichocarpa] gi|222861131|gb|EEE98673.1| predicted protein [Populus trichocarpa] Length = 632 Score = 87.0 bits (214), Expect = 1e-15 Identities = 41/62 (66%), Positives = 49/62 (79%) Frame = -1 Query: 188 PISDISSDLAVEVGTRTFPLHRLPLISRSGKIQKLLQEAKDAKFCRLTVTGVPGGAEAFE 9 PISD+SSDL VEVG F LH+ PL+SRSG+I+KLL EAKD+K R+ + VPGG EAFE Sbjct: 32 PISDVSSDLTVEVGAANFALHKFPLVSRSGRIRKLLLEAKDSKISRINIPAVPGGPEAFE 91 Query: 8 LA 3 LA Sbjct: 92 LA 93