BLASTX nr result
ID: Bupleurum21_contig00029990
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00029990 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002326167.1| predicted protein [Populus trichocarpa] gi|2... 141 6e-32 ref|XP_002525185.1| ubiquitin protein ligase E3a, putative [Rici... 139 2e-31 ref|XP_002273203.2| PREDICTED: E3 ubiquitin-protein ligase UPL4-... 138 5e-31 emb|CBI32615.3| unnamed protein product [Vitis vinifera] 138 5e-31 ref|XP_002322854.1| predicted protein [Populus trichocarpa] gi|2... 133 1e-29 >ref|XP_002326167.1| predicted protein [Populus trichocarpa] gi|222833360|gb|EEE71837.1| predicted protein [Populus trichocarpa] Length = 659 Score = 141 bits (355), Expect = 6e-32 Identities = 69/91 (75%), Positives = 78/91 (85%), Gaps = 1/91 (1%) Frame = -2 Query: 271 KMVNIINLEEYVSLIVDATIGSGISRQMEAFKLGFNQVFPIRHLQIFTEEELEHLLCGD- 95 K+VN++NL+ YVS IVDATI +GISRQ+EAFK GFNQVFPI+HL IFTEEELE LLCG+ Sbjct: 468 KIVNMVNLDAYVSRIVDATIHTGISRQVEAFKSGFNQVFPIKHLMIFTEEELERLLCGER 527 Query: 94 EVWNINELLDHIKFDHGYASSCPPVVNLLSI 2 E W NELLDHIKFDHGY +S PPVVNLL I Sbjct: 528 EFWAFNELLDHIKFDHGYTASSPPVVNLLEI 558 >ref|XP_002525185.1| ubiquitin protein ligase E3a, putative [Ricinus communis] gi|223535482|gb|EEF37151.1| ubiquitin protein ligase E3a, putative [Ricinus communis] Length = 1561 Score = 139 bits (351), Expect = 2e-31 Identities = 66/91 (72%), Positives = 77/91 (84%), Gaps = 1/91 (1%) Frame = -2 Query: 271 KMVNIINLEEYVSLIVDATIGSGISRQMEAFKLGFNQVFPIRHLQIFTEEELEHLLCGD- 95 KMVN+ NLEEY+SL+VDATI +GISRQ+EAFK GFNQVFPI+HLQ+FT EELE LLCG+ Sbjct: 1383 KMVNMDNLEEYISLVVDATINAGISRQVEAFKSGFNQVFPIKHLQVFTVEELERLLCGEH 1442 Query: 94 EVWNINELLDHIKFDHGYASSCPPVVNLLSI 2 + W NEL DHIKFDHGY +S PP+ NLL I Sbjct: 1443 DFWVYNELFDHIKFDHGYTASSPPITNLLEI 1473 >ref|XP_002273203.2| PREDICTED: E3 ubiquitin-protein ligase UPL4-like [Vitis vinifera] Length = 1575 Score = 138 bits (347), Expect = 5e-31 Identities = 66/91 (72%), Positives = 77/91 (84%), Gaps = 1/91 (1%) Frame = -2 Query: 271 KMVNIINLEEYVSLIVDATIGSGISRQMEAFKLGFNQVFPIRHLQIFTEEELEHLLCGD- 95 KMV + NLEEYVSL+VD TI +GISRQ+EAF+ GFNQVFPI+HLQIFTEEELE LLCG+ Sbjct: 1397 KMVTMTNLEEYVSLLVDTTINAGISRQVEAFRSGFNQVFPIKHLQIFTEEELEKLLCGER 1456 Query: 94 EVWNINELLDHIKFDHGYASSCPPVVNLLSI 2 + W N LLDHIKFDHGY +S PP++NLL I Sbjct: 1457 DSWACNGLLDHIKFDHGYTASSPPIINLLEI 1487 >emb|CBI32615.3| unnamed protein product [Vitis vinifera] Length = 1487 Score = 138 bits (347), Expect = 5e-31 Identities = 66/91 (72%), Positives = 77/91 (84%), Gaps = 1/91 (1%) Frame = -2 Query: 271 KMVNIINLEEYVSLIVDATIGSGISRQMEAFKLGFNQVFPIRHLQIFTEEELEHLLCGD- 95 KMV + NLEEYVSL+VD TI +GISRQ+EAF+ GFNQVFPI+HLQIFTEEELE LLCG+ Sbjct: 1309 KMVTMTNLEEYVSLLVDTTINAGISRQVEAFRSGFNQVFPIKHLQIFTEEELEKLLCGER 1368 Query: 94 EVWNINELLDHIKFDHGYASSCPPVVNLLSI 2 + W N LLDHIKFDHGY +S PP++NLL I Sbjct: 1369 DSWACNGLLDHIKFDHGYTASSPPIINLLEI 1399 >ref|XP_002322854.1| predicted protein [Populus trichocarpa] gi|222867484|gb|EEF04615.1| predicted protein [Populus trichocarpa] Length = 650 Score = 133 bits (335), Expect = 1e-29 Identities = 65/88 (73%), Positives = 75/88 (85%), Gaps = 1/88 (1%) Frame = -2 Query: 271 KMVNIINLEEYVSLIVDATIGSGISRQMEAFKLGFNQVFPIRHLQIFTEEELEHLLCGD- 95 K+VN+ NLE YVS IVDATI +GISRQ+EAFK GFNQVFPI+HL IFTEEELE LLCG+ Sbjct: 464 KIVNMDNLEVYVSHIVDATIHTGISRQVEAFKSGFNQVFPIKHLMIFTEEELERLLCGER 523 Query: 94 EVWNINELLDHIKFDHGYASSCPPVVNL 11 + W NELLDHIKFDHGY +S PP+VN+ Sbjct: 524 DFWAFNELLDHIKFDHGYTASSPPIVNV 551