BLASTX nr result
ID: Bupleurum21_contig00029952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00029952 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC39094.1| remorin-3 protein [Dimocarpus longan] 103 1e-20 gb|AFB69339.1| remorin-1d, partial [Dimocarpus longan] 103 1e-20 ref|XP_002300338.1| predicted protein [Populus trichocarpa] gi|2... 99 4e-19 emb|CAN71634.1| hypothetical protein VITISV_036630 [Vitis vinifera] 97 1e-18 ref|XP_002272255.1| PREDICTED: uncharacterized protein LOC100256... 97 2e-18 >gb|AGC39094.1| remorin-3 protein [Dimocarpus longan] Length = 541 Score = 103 bits (257), Expect = 1e-20 Identities = 53/67 (79%), Positives = 60/67 (89%), Gaps = 1/67 (1%) Frame = -2 Query: 199 MDYERIHRPQTGIISPSKLRMKLMG-QQRKKEGSNSNSARTSPSKLEDTEFVRNSLLASN 23 MDYERIH+ QTGIISPSKLRMKL+G RKKEGSNSNS+RTSP+KL+D+EFVRNSLLASN Sbjct: 1 MDYERIHKVQTGIISPSKLRMKLIGPHNRKKEGSNSNSSRTSPAKLDDSEFVRNSLLASN 60 Query: 22 VDDYYEE 2 D+ EE Sbjct: 61 GGDFDEE 67 >gb|AFB69339.1| remorin-1d, partial [Dimocarpus longan] Length = 249 Score = 103 bits (257), Expect = 1e-20 Identities = 53/67 (79%), Positives = 60/67 (89%), Gaps = 1/67 (1%) Frame = -2 Query: 199 MDYERIHRPQTGIISPSKLRMKLMG-QQRKKEGSNSNSARTSPSKLEDTEFVRNSLLASN 23 MDYERIH+ QTGIISPSKLRMKL+G RKKEGSNSNS+RTSP+KL+D+EFVRNSLLASN Sbjct: 1 MDYERIHKVQTGIISPSKLRMKLIGPHNRKKEGSNSNSSRTSPAKLDDSEFVRNSLLASN 60 Query: 22 VDDYYEE 2 D+ EE Sbjct: 61 GGDFDEE 67 >ref|XP_002300338.1| predicted protein [Populus trichocarpa] gi|222847596|gb|EEE85143.1| predicted protein [Populus trichocarpa] Length = 528 Score = 99.0 bits (245), Expect = 4e-19 Identities = 50/68 (73%), Positives = 59/68 (86%), Gaps = 2/68 (2%) Frame = -2 Query: 199 MDYERIHRPQTGIISPSKLRMKLMG--QQRKKEGSNSNSARTSPSKLEDTEFVRNSLLAS 26 MDYERIH+ Q+GIISPSKLRMKL+G RKK+GSNSNS+RTSPSKL+D EFV+NSLLAS Sbjct: 1 MDYERIHKVQSGIISPSKLRMKLVGPHHNRKKDGSNSNSSRTSPSKLQDNEFVKNSLLAS 60 Query: 25 NVDDYYEE 2 + D+ EE Sbjct: 61 DFGDFGEE 68 >emb|CAN71634.1| hypothetical protein VITISV_036630 [Vitis vinifera] Length = 585 Score = 97.4 bits (241), Expect = 1e-18 Identities = 50/63 (79%), Positives = 56/63 (88%), Gaps = 2/63 (3%) Frame = -2 Query: 211 EKKQMDYERIHRPQTGIISPSKLRMKLMG--QQRKKEGSNSNSARTSPSKLEDTEFVRNS 38 E M+YERIH+ QTGIISPSKLRMKLMG QRKK+GSNSNS+RTSPSKLED+EFV+NS Sbjct: 56 ESXLMEYERIHKVQTGIISPSKLRMKLMGPHHQRKKDGSNSNSSRTSPSKLEDSEFVKNS 115 Query: 37 LLA 29 LLA Sbjct: 116 LLA 118 >ref|XP_002272255.1| PREDICTED: uncharacterized protein LOC100256651 [Vitis vinifera] gi|297740766|emb|CBI30948.3| unnamed protein product [Vitis vinifera] Length = 526 Score = 96.7 bits (239), Expect = 2e-18 Identities = 49/59 (83%), Positives = 55/59 (93%), Gaps = 2/59 (3%) Frame = -2 Query: 199 MDYERIHRPQTGIISPSKLRMKLMG--QQRKKEGSNSNSARTSPSKLEDTEFVRNSLLA 29 M+YERIH+ QTGIISPSKLRMKLMG QRKK+GSNSNS+RTSPSKLED+EFV+NSLLA Sbjct: 1 MEYERIHKVQTGIISPSKLRMKLMGPHHQRKKDGSNSNSSRTSPSKLEDSEFVKNSLLA 59