BLASTX nr result
ID: Bupleurum21_contig00029939
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00029939 (498 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530980.1| conserved hypothetical protein [Ricinus comm... 80 2e-13 ref|XP_002306375.1| predicted protein [Populus trichocarpa] gi|2... 80 2e-13 ref|XP_002310063.1| predicted protein [Populus trichocarpa] gi|2... 80 2e-13 >ref|XP_002530980.1| conserved hypothetical protein [Ricinus communis] gi|223529456|gb|EEF31415.1| conserved hypothetical protein [Ricinus communis] Length = 710 Score = 80.1 bits (196), Expect = 2e-13 Identities = 36/52 (69%), Positives = 43/52 (82%) Frame = -3 Query: 157 LYVIPEDIIGLIKKDLVPGILKEPLSPQTYKDYFAALLYAEDYYLEKWDGFE 2 +Y+IP+DI LIK D VP +LK+PLS TYKDYFAALLYAEDYY+EKW F+ Sbjct: 274 IYMIPKDIESLIKSDKVPEVLKKPLSLSTYKDYFAALLYAEDYYIEKWSKFK 325 >ref|XP_002306375.1| predicted protein [Populus trichocarpa] gi|222855824|gb|EEE93371.1| predicted protein [Populus trichocarpa] Length = 773 Score = 79.7 bits (195), Expect = 2e-13 Identities = 34/52 (65%), Positives = 43/52 (82%) Frame = -3 Query: 157 LYVIPEDIIGLIKKDLVPGILKEPLSPQTYKDYFAALLYAEDYYLEKWDGFE 2 +Y +P+DI LIK+D+VP +L E LSP TYKDYFAALLYAED+Y+EKW F+ Sbjct: 325 IYAVPKDIEDLIKRDIVPEVLNEMLSPSTYKDYFAALLYAEDFYIEKWSKFK 376 >ref|XP_002310063.1| predicted protein [Populus trichocarpa] gi|222852966|gb|EEE90513.1| predicted protein [Populus trichocarpa] Length = 687 Score = 79.7 bits (195), Expect = 2e-13 Identities = 35/52 (67%), Positives = 43/52 (82%) Frame = -3 Query: 157 LYVIPEDIIGLIKKDLVPGILKEPLSPQTYKDYFAALLYAEDYYLEKWDGFE 2 +Y IP+DI LIK+D VPG+L +PLS TYKDYFAALLYAED+Y+EKW F+ Sbjct: 243 IYAIPKDIEDLIKRDKVPGVLNKPLSLSTYKDYFAALLYAEDFYIEKWSEFK 294