BLASTX nr result
ID: Bupleurum21_contig00029882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00029882 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACR37723.1| unknown [Zea mays] 69 5e-10 ref|XP_002465410.1| hypothetical protein SORBIDRAFT_01g038240 [S... 62 4e-08 ref|NP_001151600.1| mitochondrial import inner membrane transloc... 62 4e-08 ref|XP_002275144.1| PREDICTED: mitochondrial import inner membra... 60 1e-07 ref|XP_003534366.1| PREDICTED: mitochondrial import inner membra... 60 2e-07 >gb|ACR37723.1| unknown [Zea mays] Length = 216 Score = 68.6 bits (166), Expect = 5e-10 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = +1 Query: 1 PRNNPMNSPSAPPITPLVTLRTAQLFQMSCPRTSSMVGNRMGSTA 135 P+N+P+++P PP+TPL TLRTAQLFQMSCP SS VG R+GSTA Sbjct: 117 PKNSPISTPRPPPMTPLTTLRTAQLFQMSCPLISSTVGIRIGSTA 161 >ref|XP_002465410.1| hypothetical protein SORBIDRAFT_01g038240 [Sorghum bicolor] gi|241919264|gb|EER92408.1| hypothetical protein SORBIDRAFT_01g038240 [Sorghum bicolor] Length = 170 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -1 Query: 152 SLNEPRAVEPMRLPTIEEVRGQDIWNNCAVRSVTSGV 42 S ++ AVEP+R+PT+EE++GQDIWNNCAVRSV SGV Sbjct: 17 STSQAAAVEPIRMPTVEEIKGQDIWNNCAVRSVVSGV 53 >ref|NP_001151600.1| mitochondrial import inner membrane translocase subunit tim22 [Zea mays] gi|195648036|gb|ACG43486.1| mitochondrial import inner membrane translocase subunit tim22 [Zea mays] gi|414866331|tpg|DAA44888.1| TPA: import inner membrane translocase subunit tim22 [Zea mays] Length = 170 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -1 Query: 152 SLNEPRAVEPMRLPTIEEVRGQDIWNNCAVRSVTSGV 42 S ++ AVEP+R+PT+EE++GQDIWNNCAVRSV SGV Sbjct: 17 STSQAAAVEPIRMPTVEEIKGQDIWNNCAVRSVVSGV 53 >ref|XP_002275144.1| PREDICTED: mitochondrial import inner membrane translocase subunit tim22 [Vitis vinifera] gi|297745845|emb|CBI15901.3| unnamed protein product [Vitis vinifera] Length = 170 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 143 EPRAVEPMRLPTIEEVRGQDIWNNCAVRSVTSGV 42 E +EP+R+PT+EE+RGQDIWNNCAVRSV SGV Sbjct: 20 EKPQIEPIRMPTVEEIRGQDIWNNCAVRSVASGV 53 >ref|XP_003534366.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM22-like [Glycine max] Length = 170 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 4/41 (9%) Frame = -1 Query: 152 SLNEPRA----VEPMRLPTIEEVRGQDIWNNCAVRSVTSGV 42 SLN R +EP+RLP++EE+RGQDIWNNCAVRSV SGV Sbjct: 13 SLNSTRLENPQIEPIRLPSVEEIRGQDIWNNCAVRSVVSGV 53