BLASTX nr result
ID: Bupleurum21_contig00029658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00029658 (353 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631220.1| PREDICTED: glutaminyl-tRNA synthetase isofor... 66 3e-09 ref|XP_002283636.1| PREDICTED: glutaminyl-tRNA synthetase isofor... 66 3e-09 ref|XP_002526992.1| glutaminyl-tRNA synthetase, putative [Ricinu... 65 8e-09 ref|XP_002270305.1| PREDICTED: glutaminyl-tRNA synthetase [Vitis... 64 2e-08 emb|CAN74682.1| hypothetical protein VITISV_036765 [Vitis vinifera] 64 2e-08 >ref|XP_003631220.1| PREDICTED: glutaminyl-tRNA synthetase isoform 2 [Vitis vinifera] Length = 802 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 QFERLGYYSVDKDSTSDKLVFNRTVTLRDSYAKVGK 108 QFERLGY+ VDKDSTS+KLVFNRTVTLRDSY+K GK Sbjct: 767 QFERLGYFVVDKDSTSEKLVFNRTVTLRDSYSKGGK 802 >ref|XP_002283636.1| PREDICTED: glutaminyl-tRNA synthetase isoform 1 [Vitis vinifera] gi|297737799|emb|CBI27000.3| unnamed protein product [Vitis vinifera] Length = 791 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 QFERLGYYSVDKDSTSDKLVFNRTVTLRDSYAKVGK 108 QFERLGY+ VDKDSTS+KLVFNRTVTLRDSY+K GK Sbjct: 756 QFERLGYFVVDKDSTSEKLVFNRTVTLRDSYSKGGK 791 >ref|XP_002526992.1| glutaminyl-tRNA synthetase, putative [Ricinus communis] gi|223533627|gb|EEF35364.1| glutaminyl-tRNA synthetase, putative [Ricinus communis] Length = 793 Score = 64.7 bits (156), Expect = 8e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 1 QFERLGYYSVDKDSTSDKLVFNRTVTLRDSYAKVGK 108 QFERLGY++VDKDST +KLVFNRTVTLRDSY K GK Sbjct: 758 QFERLGYFTVDKDSTPEKLVFNRTVTLRDSYGKGGK 793 >ref|XP_002270305.1| PREDICTED: glutaminyl-tRNA synthetase [Vitis vinifera] gi|297734636|emb|CBI16687.3| unnamed protein product [Vitis vinifera] Length = 790 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 1 QFERLGYYSVDKDSTSDKLVFNRTVTLRDSYAKVGK 108 QFERLGY+ VDKDST +KLVFNRTVTLRDSY K GK Sbjct: 755 QFERLGYFVVDKDSTPEKLVFNRTVTLRDSYGKGGK 790 >emb|CAN74682.1| hypothetical protein VITISV_036765 [Vitis vinifera] Length = 483 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 1 QFERLGYYSVDKDSTSDKLVFNRTVTLRDSYAKVGK 108 QFERLGY+ VDKDST +KLVFNRTVTLRDSY K GK Sbjct: 448 QFERLGYFVVDKDSTPEKLVFNRTVTLRDSYGKGGK 483