BLASTX nr result
ID: Bupleurum21_contig00029607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00029607 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529729.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 ref|XP_002267590.1| PREDICTED: uncharacterized protein LOC100243... 61 8e-08 ref|XP_002509798.1| conserved hypothetical protein [Ricinus comm... 60 1e-07 ref|XP_003637473.1| hypothetical protein MTR_087s0009 [Medicago ... 55 6e-06 ref|XP_003637349.1| hypothetical protein MTR_082s0033 [Medicago ... 55 6e-06 >ref|XP_002529729.1| conserved hypothetical protein [Ricinus communis] gi|223530793|gb|EEF32658.1| conserved hypothetical protein [Ricinus communis] Length = 290 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -3 Query: 222 ESGETVSASNKRKKKSWTSLKEIAESSENSNRRNLTDLPIPFFI 91 +S TV+AS+KRK+KSWTSLKEIAES E+ + RN+T+L IPF I Sbjct: 247 DSERTVNASSKRKRKSWTSLKEIAESKEHDSTRNVTNLTIPFLI 290 >ref|XP_002267590.1| PREDICTED: uncharacterized protein LOC100243390 [Vitis vinifera] Length = 301 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/53 (52%), Positives = 40/53 (75%) Frame = -3 Query: 249 ESPNCSTVIESGETVSASNKRKKKSWTSLKEIAESSENSNRRNLTDLPIPFFI 91 E + S ++ ++VS SNKR++KSWTSL+EIAE+SE N RN+ +L IPFF+ Sbjct: 249 EPESNSASADTQKSVSTSNKRRRKSWTSLREIAETSEQGNTRNIANLTIPFFL 301 >ref|XP_002509798.1| conserved hypothetical protein [Ricinus communis] gi|223549697|gb|EEF51185.1| conserved hypothetical protein [Ricinus communis] Length = 293 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/53 (54%), Positives = 39/53 (73%) Frame = -3 Query: 249 ESPNCSTVIESGETVSASNKRKKKSWTSLKEIAESSENSNRRNLTDLPIPFFI 91 ES N + + T +AS+KRK+KSWTSLKEIAES E+ + +N+ +L IPFFI Sbjct: 241 ESDNTNAAKDGERTGNASSKRKRKSWTSLKEIAESKEHDSTQNVANLAIPFFI 293 >ref|XP_003637473.1| hypothetical protein MTR_087s0009 [Medicago truncatula] gi|355503408|gb|AES84611.1| hypothetical protein MTR_087s0009 [Medicago truncatula] Length = 197 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/54 (55%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = -3 Query: 249 ESPNCSTVIESGETVSASNKRKKKSWTSLKEIAESS-ENSNRRNLTDLPIPFFI 91 E+P+ S +E +T S S+KR+KKSWTSLKEIA+S +NS NLT IPFF+ Sbjct: 147 ETPSMSARVEGAKTQSTSSKRRKKSWTSLKEIAQSKHDNSQVANLT---IPFFL 197 >ref|XP_003637349.1| hypothetical protein MTR_082s0033 [Medicago truncatula] gi|355503284|gb|AES84487.1| hypothetical protein MTR_082s0033 [Medicago truncatula] Length = 287 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/54 (55%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = -3 Query: 249 ESPNCSTVIESGETVSASNKRKKKSWTSLKEIAESS-ENSNRRNLTDLPIPFFI 91 E+P+ S +E +T S S+KR+KKSWTSLKEIA+S +NS NLT IPFF+ Sbjct: 237 ETPSMSARVEGAKTQSTSSKRRKKSWTSLKEIAQSKHDNSQVANLT---IPFFL 287