BLASTX nr result
ID: Bupleurum21_contig00028932
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00028932 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264386.1| PREDICTED: putative pentatricopeptide repeat... 133 1e-29 emb|CAN64813.1| hypothetical protein VITISV_024998 [Vitis vinifera] 133 1e-29 ref|XP_002511392.1| pentatricopeptide repeat-containing protein,... 130 1e-28 gb|ADN33897.1| pentatricopeptide (PPR) repeat-containing protein... 117 7e-25 ref|XP_004139961.1| PREDICTED: putative pentatricopeptide repeat... 117 1e-24 >ref|XP_002264386.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g03510 [Vitis vinifera] gi|298205226|emb|CBI17285.3| unnamed protein product [Vitis vinifera] Length = 430 Score = 133 bits (335), Expect = 1e-29 Identities = 67/100 (67%), Positives = 83/100 (83%) Frame = +2 Query: 2 KNVVMWNAMISIYAHCSDHVCEALQLFKVMDVVPNHSTFNSIIAGLSEMEDGSSKAIEFY 181 +N+V+WNAMISIY H S V +AL LF+VMDV PN STFN+II+GLS +EDGS KA+ FY Sbjct: 111 RNIVVWNAMISIYTH-SGRVADALGLFEVMDVEPNASTFNAIISGLSGLEDGSFKALSFY 169 Query: 182 RRMQVLGLKPNMITVLALLHSCVGMAALNMIKEIHGYSIR 301 RRM +GLK N+IT+LALL +CV +AAL +IKEIHGY+IR Sbjct: 170 RRMGEVGLKQNLITLLALLPACVDLAALTLIKEIHGYAIR 209 >emb|CAN64813.1| hypothetical protein VITISV_024998 [Vitis vinifera] Length = 513 Score = 133 bits (335), Expect = 1e-29 Identities = 67/100 (67%), Positives = 83/100 (83%) Frame = +2 Query: 2 KNVVMWNAMISIYAHCSDHVCEALQLFKVMDVVPNHSTFNSIIAGLSEMEDGSSKAIEFY 181 +N+V+WNAMISIY H S V +AL LF+VMDV PN STFN+II+GLS +EDGS KA+ FY Sbjct: 111 RNIVVWNAMISIYTH-SGRVADALGLFEVMDVEPNASTFNAIISGLSGLEDGSFKALSFY 169 Query: 182 RRMQVLGLKPNMITVLALLHSCVGMAALNMIKEIHGYSIR 301 RRM +GLK N+IT+LALL +CV +AAL +IKEIHGY+IR Sbjct: 170 RRMGEVGLKQNLITLLALLPACVDLAALTLIKEIHGYAIR 209 >ref|XP_002511392.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550507|gb|EEF51994.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 441 Score = 130 bits (327), Expect = 1e-28 Identities = 64/100 (64%), Positives = 84/100 (84%) Frame = +2 Query: 2 KNVVMWNAMISIYAHCSDHVCEALQLFKVMDVVPNHSTFNSIIAGLSEMEDGSSKAIEFY 181 +NVV+WNAMIS+Y H S+ V +AL +F M++ PN STFN++I GLS ++DGS KAI FY Sbjct: 127 RNVVVWNAMISLYTH-SNRVRDALDMFDAMEIEPNVSTFNALIYGLSGVKDGSIKAIAFY 185 Query: 182 RRMQVLGLKPNMITVLALLHSCVGMAALNMIKEIHGYSIR 301 +M+ LGLKPN+IT+LALL +CVG+AALN+I+EIHGYSIR Sbjct: 186 WKMRQLGLKPNLITLLALLPACVGIAALNLIREIHGYSIR 225 >gb|ADN33897.1| pentatricopeptide (PPR) repeat-containing protein [Cucumis melo subsp. melo] Length = 391 Score = 117 bits (294), Expect = 7e-25 Identities = 59/100 (59%), Positives = 83/100 (83%) Frame = +2 Query: 2 KNVVMWNAMISIYAHCSDHVCEALQLFKVMDVVPNHSTFNSIIAGLSEMEDGSSKAIEFY 181 ++VV+WN M+S+Y H S+ + ALQLF+ MDV PN S+FN I+AGLS++EDG KAI FY Sbjct: 75 RSVVVWNVMLSLYVH-SNMLFGALQLFEAMDVPPNASSFNPIVAGLSKLEDGF-KAIAFY 132 Query: 182 RRMQVLGLKPNMITVLALLHSCVGMAALNMIKEIHGYSIR 301 R+MQ GLKPN+IT+LALL + VG+A+L++IK+IHG+++R Sbjct: 133 RQMQQCGLKPNLITLLALLPASVGVASLDLIKQIHGFAMR 172 >ref|XP_004139961.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g03510-like [Cucumis sativus] Length = 391 Score = 117 bits (293), Expect = 1e-24 Identities = 58/100 (58%), Positives = 84/100 (84%) Frame = +2 Query: 2 KNVVMWNAMISIYAHCSDHVCEALQLFKVMDVVPNHSTFNSIIAGLSEMEDGSSKAIEFY 181 ++VV+WN M+S+Y H ++ + ALQLF+ MDV PN S+FN+I+AGLS++EDG KAI FY Sbjct: 75 RSVVVWNVMLSLYVH-ANMLFGALQLFEAMDVPPNASSFNAIVAGLSKLEDGF-KAIAFY 132 Query: 182 RRMQVLGLKPNMITVLALLHSCVGMAALNMIKEIHGYSIR 301 R+MQ GLKPN+IT+LALL + VG+A+L++IK+IHG+++R Sbjct: 133 RQMQQCGLKPNLITLLALLPASVGVASLDLIKQIHGFAMR 172