BLASTX nr result
ID: Bupleurum21_contig00028773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00028773 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522615.1| pentatricopeptide repeat-containing protein,... 55 6e-06 >ref|XP_002522615.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538091|gb|EEF39702.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 426 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/55 (50%), Positives = 39/55 (70%), Gaps = 2/55 (3%) Frame = -1 Query: 160 KNDLWSRFFGLR--DKTPTMVLQNWVDDGNQVSDSELRRIVHGLYKIKRYKHALE 2 ++DL SR F LR ++ T ++ NWV +GN V+ SELR I + L K++RYKHALE Sbjct: 73 EDDLKSRIFRLRLPKRSATNIIHNWVSEGNTVTASELRNISNELRKLQRYKHALE 127