BLASTX nr result
ID: Bupleurum21_contig00028687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00028687 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004146527.1| PREDICTED: glutathione S-transferase T1-like... 62 5e-08 gb|ACI16511.1| glutathione S-transferase [Cucumis sativus] 62 5e-08 gb|AAW84273.1| gluthatione S-transferase [Helianthus annuus x He... 61 1e-07 gb|ADB11338.1| theta class glutathione transferase GSTT2 [Populu... 60 2e-07 ref|XP_002304489.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 >ref|XP_004146527.1| PREDICTED: glutathione S-transferase T1-like [Cucumis sativus] gi|449516399|ref|XP_004165234.1| PREDICTED: glutathione S-transferase T1-like [Cucumis sativus] Length = 238 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +1 Query: 1 VADHWYPSNILQRAKIHSVLDWHHPNLRQGSGE***PLCFKSI 129 VADHWYP+++ +RAKIHSVLDWHH NLR G+ PL F ++ Sbjct: 81 VADHWYPADLFRRAKIHSVLDWHHSNLRSGAA----PLIFNTV 119 >gb|ACI16511.1| glutathione S-transferase [Cucumis sativus] Length = 184 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +1 Query: 1 VADHWYPSNILQRAKIHSVLDWHHPNLRQGSGE***PLCFKSI 129 VADHWYP+++ +RAKIHSVLDWHH NLR G+ PL F ++ Sbjct: 54 VADHWYPADLFRRAKIHSVLDWHHSNLRSGAA----PLIFNTV 92 >gb|AAW84273.1| gluthatione S-transferase [Helianthus annuus x Helianthus debilis subsp. debilis] Length = 127 Score = 60.8 bits (146), Expect = 1e-07 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 1 VADHWYPSNILQRAKIHSVLDWHHPNLRQGS 93 VA HWYPS++++RAK+HSVLDWHH NLR+GS Sbjct: 3 VASHWYPSDLVERAKVHSVLDWHHANLRRGS 33 >gb|ADB11338.1| theta class glutathione transferase GSTT2 [Populus trichocarpa] Length = 232 Score = 60.1 bits (144), Expect = 2e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +1 Query: 1 VADHWYPSNILQRAKIHSVLDWHHPNLRQGSGE 99 VADHWYP+++ +RA+IHS+LDWHH NLR+GS E Sbjct: 82 VADHWYPADLYRRAEIHSILDWHHSNLRRGSVE 114 >ref|XP_002304489.1| predicted protein [Populus trichocarpa] gi|222841921|gb|EEE79468.1| predicted protein [Populus trichocarpa] Length = 232 Score = 60.1 bits (144), Expect = 2e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +1 Query: 1 VADHWYPSNILQRAKIHSVLDWHHPNLRQGSGE 99 VADHWYP+++ +RA+IHS+LDWHH NLR+GS E Sbjct: 82 VADHWYPADLYRRAEIHSILDWHHSNLRRGSVE 114