BLASTX nr result
ID: Bupleurum21_contig00028425
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00028425 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529689.1| conserved hypothetical protein [Ricinus comm... 63 2e-08 >ref|XP_002529689.1| conserved hypothetical protein [Ricinus communis] gi|223530837|gb|EEF32700.1| conserved hypothetical protein [Ricinus communis] Length = 119 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/80 (35%), Positives = 49/80 (61%) Frame = -1 Query: 298 WTAMQGYQQCIFETDSHALALACNGNNGRAFFGTIVDDCIYLLKHINLVLVEFVYRSANM 119 W Q +++CI E+D+ + A + ++ F I+DDC +L++H V +FV RSAN Sbjct: 29 WLKQQIFEECIIESDALQVIEALKAPSSQSCFHLIIDDCKHLVQHFRQVHFQFVRRSANT 88 Query: 118 VAHVLAQASYSMSDLGEWFN 59 A ++A+ +YS+S +WF+ Sbjct: 89 AAQIVARGAYSLSGPMDWFH 108