BLASTX nr result
ID: Bupleurum21_contig00028277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00028277 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006607893.1| transcriptional transactivator [Soybean Putn... 66 3e-09 ref|YP_006907835.1| inclusion body matrix protein [Horseradish l... 56 1e-06 ref|YP_001931968.1| inclusion body/transactivation factor [Eupat... 57 2e-06 ref|NP_612578.1| Inclusion body matrix protein [Carnation etched... 52 3e-06 emb|CAH68830.1| inclusion body matrix protein [Carnation etched ... 52 4e-06 >ref|YP_006607893.1| transcriptional transactivator [Soybean Putnam virus] gi|401620161|gb|AFP95351.1| transcriptional transactivator [Soybean Putnam virus] Length = 534 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/56 (51%), Positives = 41/56 (73%) Frame = -3 Query: 169 EKIYTTDKTNISYINAYPNAPADIIFDAFVYGLLKVIYPSENLQEIQHFPKLFRSA 2 E+ +TTD N+SY N N+ D +++AF YGL+++IYPS NLQE++ FPK F SA Sbjct: 275 ERFFTTDNANVSYFNFLKNSHPDQVYEAFRYGLVRMIYPSNNLQELKSFPKGFVSA 330 >ref|YP_006907835.1| inclusion body matrix protein [Horseradish latent virus] gi|57790328|gb|AAW56090.1| inclusion body matrix protein [Horseradish latent virus] Length = 524 Score = 56.2 bits (134), Expect(2) = 1e-06 Identities = 27/53 (50%), Positives = 34/53 (64%) Frame = -3 Query: 160 YTTDKTNISYINAYPNAPADIIFDAFVYGLLKVIYPSENLQEIQHFPKLFRSA 2 +TTDK NIS N NA +I + F GL+K IYPS NLQEI++ PK + A Sbjct: 269 FTTDKKNISMFNFLKNADPQMISECFQAGLIKTIYPSANLQEIKYLPKKIKDA 321 Score = 21.2 bits (43), Expect(2) = 1e-06 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -2 Query: 212 QVMFEEFDYLYKYARK 165 ++ E+F YLY RK Sbjct: 244 EITIEDFQYLYDLGRK 259 >ref|YP_001931968.1| inclusion body/transactivation factor [Eupatorium vein clearing virus] gi|172041765|gb|ACB69774.1| inclusion body/transactivation factor [Eupatorium vein clearing virus] Length = 462 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/49 (48%), Positives = 35/49 (71%) Frame = -3 Query: 166 KIYTTDKTNISYINAYPNAPADIIFDAFVYGLLKVIYPSENLQEIQHFP 20 K +TTDK +IS N P A +++++AF YGL+ IYP+ENL E++ FP Sbjct: 267 KFFTTDKKDISMFNFVPGANPELVYEAFCYGLVSQIYPAENLLELRSFP 315 >ref|NP_612578.1| Inclusion body matrix protein [Carnation etched ring virus] gi|124051|sp|P05401.1|IBMP_CERV RecName: Full=Transactivator/viroplasmin protein; Short=Tav; AltName: Full=Inclusion body matrix protein gi|58864|emb|CAA28361.1| unnamed protein product [Carnation etched ring virus] gi|225357|prf||1301227F ORF 6 Length = 496 Score = 52.4 bits (124), Expect(2) = 3e-06 Identities = 23/58 (39%), Positives = 39/58 (67%) Frame = -3 Query: 175 MLEKIYTTDKTNISYINAYPNAPADIIFDAFVYGLLKVIYPSENLQEIQHFPKLFRSA 2 + ++ +T DK ISY+N N+ + I ++F GL++ IYPS NLQE++ PK+ +S+ Sbjct: 257 LTDRAFTIDKKEISYLNFVNNSDPEGILESFKAGLVRFIYPSTNLQELRLLPKVLKSS 314 Score = 23.5 bits (49), Expect(2) = 3e-06 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = -2 Query: 302 STMKVLGKKT---VPDKEQLFWNEEFEDFDVSCQVMFEEFDYLYKYAR 168 S MK LGK + + + + +N EF+ + F Y+YKY R Sbjct: 211 SNMKSLGKPKFIKIEEDDDVGFNPEFD---------LKSFLYIYKYGR 249 >emb|CAH68830.1| inclusion body matrix protein [Carnation etched ring virus] Length = 496 Score = 52.0 bits (123), Expect(2) = 4e-06 Identities = 24/58 (41%), Positives = 39/58 (67%) Frame = -3 Query: 175 MLEKIYTTDKTNISYINAYPNAPADIIFDAFVYGLLKVIYPSENLQEIQHFPKLFRSA 2 + ++ +T DK ISY+N N+ + I ++F GL++ IYPS NLQE++ PK+ RS+ Sbjct: 257 LTDRAFTIDKKEISYLNFVNNSDPEGILESFKAGLVRFIYPSTNLQELRLLPKVPRSS 314 Score = 23.5 bits (49), Expect(2) = 4e-06 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = -2 Query: 302 STMKVLGKKT---VPDKEQLFWNEEFEDFDVSCQVMFEEFDYLYKYAR 168 S MK LGK + + + + +N EF+ + F Y+YKY R Sbjct: 211 SNMKSLGKPKFIKIEEDDDVGFNPEFD---------LKSFLYIYKYGR 249