BLASTX nr result
ID: Bupleurum21_contig00028182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00028182 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001242075.1| uncharacterized protein LOC100783410 precurs... 102 3e-20 ref|NP_001242777.1| uncharacterized protein LOC100784352 precurs... 101 6e-20 ref|NP_197067.2| COBRA-like protein 4 [Arabidopsis thaliana] gi|... 101 7e-20 gb|AAR13305.1| phytochelatin synthetase-like protein [Phaseolus ... 101 7e-20 emb|CAC01762.1| putative phytochelatin synthetase [Arabidopsis t... 101 7e-20 >ref|NP_001242075.1| uncharacterized protein LOC100783410 precursor [Glycine max] gi|255635770|gb|ACU18234.1| unknown [Glycine max] Length = 431 Score = 102 bits (254), Expect = 3e-20 Identities = 43/59 (72%), Positives = 54/59 (91%) Frame = -2 Query: 326 SEVLLQKDQNTFTFKRGWAFPRKVYFNGEECMLPPPDAYPILPNTANGNLIRYSTFIVS 150 SE+LLQK+Q+TFTFK+GWAFPRKVYFNGEECMLPPPD+YPILPN+A NL+ + F+++ Sbjct: 365 SEILLQKNQDTFTFKQGWAFPRKVYFNGEECMLPPPDSYPILPNSAPVNLLNFPAFVLT 423 >ref|NP_001242777.1| uncharacterized protein LOC100784352 precursor [Glycine max] gi|255634735|gb|ACU17729.1| unknown [Glycine max] Length = 431 Score = 101 bits (252), Expect = 6e-20 Identities = 44/57 (77%), Positives = 51/57 (89%) Frame = -2 Query: 326 SEVLLQKDQNTFTFKRGWAFPRKVYFNGEECMLPPPDAYPILPNTANGNLIRYSTFI 156 SE+LLQK+Q TFTFK+GWAFPRKVYFNGEECMLPPPD+YPILPN+A NL+ + FI Sbjct: 365 SEILLQKNQETFTFKQGWAFPRKVYFNGEECMLPPPDSYPILPNSAPVNLLNFPAFI 421 >ref|NP_197067.2| COBRA-like protein 4 [Arabidopsis thaliana] gi|34222647|sp|Q9LFW3.2|COBL4_ARATH RecName: Full=COBRA-like protein 4; Flags: Precursor gi|48525349|gb|AAT44976.1| At5g15630 [Arabidopsis thaliana] gi|56790214|gb|AAW30024.1| At5g15630 [Arabidopsis thaliana] gi|332004803|gb|AED92186.1| COBRA-like protein 4 [Arabidopsis thaliana] Length = 431 Score = 101 bits (251), Expect = 7e-20 Identities = 44/58 (75%), Positives = 50/58 (86%) Frame = -2 Query: 326 SEVLLQKDQNTFTFKRGWAFPRKVYFNGEECMLPPPDAYPILPNTANGNLIRYSTFIV 153 SEVLLQKDQ TFTFK+GWAFPRKVYFNG+ECMLPPPD+YP LPN+A GN +S I+ Sbjct: 366 SEVLLQKDQKTFTFKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSAQGNFASFSLTIL 423 >gb|AAR13305.1| phytochelatin synthetase-like protein [Phaseolus vulgaris] Length = 463 Score = 101 bits (251), Expect = 7e-20 Identities = 43/59 (72%), Positives = 53/59 (89%) Frame = -2 Query: 326 SEVLLQKDQNTFTFKRGWAFPRKVYFNGEECMLPPPDAYPILPNTANGNLIRYSTFIVS 150 SE+LLQKD++TFT K+GWAFPRKVYFNGEECMLPPPD YPILPN+A NL+ ++ FI++ Sbjct: 397 SEILLQKDKDTFTLKQGWAFPRKVYFNGEECMLPPPDTYPILPNSAPVNLLNFTVFILT 455 >emb|CAC01762.1| putative phytochelatin synthetase [Arabidopsis thaliana] Length = 395 Score = 101 bits (251), Expect = 7e-20 Identities = 44/58 (75%), Positives = 50/58 (86%) Frame = -2 Query: 326 SEVLLQKDQNTFTFKRGWAFPRKVYFNGEECMLPPPDAYPILPNTANGNLIRYSTFIV 153 SEVLLQKDQ TFTFK+GWAFPRKVYFNG+ECMLPPPD+YP LPN+A GN +S I+ Sbjct: 330 SEVLLQKDQKTFTFKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSAQGNFASFSLTIL 387