BLASTX nr result
ID: Bupleurum21_contig00027740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00027740 (777 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317736.1| predicted protein [Populus trichocarpa] gi|2... 78 2e-12 ref|XP_002330565.1| predicted protein [Populus trichocarpa] gi|2... 77 4e-12 ref|XP_002333553.1| predicted protein [Populus trichocarpa] gi|2... 77 4e-12 ref|XP_002330564.1| predicted protein [Populus trichocarpa] gi|2... 75 1e-11 ref|XP_002330562.1| predicted protein [Populus trichocarpa] gi|2... 75 1e-11 >ref|XP_002317736.1| predicted protein [Populus trichocarpa] gi|222858409|gb|EEE95956.1| predicted protein [Populus trichocarpa] Length = 534 Score = 77.8 bits (190), Expect = 2e-12 Identities = 41/74 (55%), Positives = 47/74 (63%) Frame = +1 Query: 532 VSFLVLLFAISSAAASTLLQDKFYQCLSQKSNIPIPFSPTFYTPNNSSFTSILESTALNL 711 VS LV+L + S +QDKF +CLS S PFS YTPNNSSFT++L STA NL Sbjct: 9 VSVLVILLSFPFFIVSLPIQDKFLKCLSLNSESSFPFSTILYTPNNSSFTNVLLSTAQNL 68 Query: 712 RFTAPSVSKPLLIF 753 RF PSV KP IF Sbjct: 69 RFALPSVPKPEFIF 82 >ref|XP_002330565.1| predicted protein [Populus trichocarpa] gi|222872123|gb|EEF09254.1| predicted protein [Populus trichocarpa] Length = 533 Score = 77.0 bits (188), Expect = 4e-12 Identities = 38/71 (53%), Positives = 48/71 (67%) Frame = +1 Query: 541 LVLLFAISSAAASTLLQDKFYQCLSQKSNIPIPFSPTFYTPNNSSFTSILESTALNLRFT 720 ++L+ +S S LQD+F +CLS+ S PFS YTP NSSFTS+L+S+A NLRFT Sbjct: 11 ILLVLLLSPFIVSHALQDRFLKCLSRTSESSFPFSTVLYTPKNSSFTSVLQSSAQNLRFT 70 Query: 721 APSVSKPLLIF 753 PSV KP IF Sbjct: 71 FPSVPKPEFIF 81 >ref|XP_002333553.1| predicted protein [Populus trichocarpa] gi|222835542|gb|EEE73977.1| predicted protein [Populus trichocarpa] Length = 544 Score = 77.0 bits (188), Expect = 4e-12 Identities = 38/71 (53%), Positives = 48/71 (67%) Frame = +1 Query: 541 LVLLFAISSAAASTLLQDKFYQCLSQKSNIPIPFSPTFYTPNNSSFTSILESTALNLRFT 720 ++L+ +S S LQD+F +CLS+ S PFS YTP NSSFTS+L+S+A NLRFT Sbjct: 11 ILLVLLLSPFIVSHALQDRFLKCLSRTSESSFPFSTVLYTPKNSSFTSVLQSSAQNLRFT 70 Query: 721 APSVSKPLLIF 753 PSV KP IF Sbjct: 71 FPSVPKPEFIF 81 >ref|XP_002330564.1| predicted protein [Populus trichocarpa] gi|222872122|gb|EEF09253.1| predicted protein [Populus trichocarpa] Length = 545 Score = 75.5 bits (184), Expect = 1e-11 Identities = 37/71 (52%), Positives = 47/71 (66%) Frame = +1 Query: 541 LVLLFAISSAAASTLLQDKFYQCLSQKSNIPIPFSPTFYTPNNSSFTSILESTALNLRFT 720 ++L+ +S S LQD F +CLS+ S PFS YTP NSSFTS+L+S+A NLRFT Sbjct: 11 ILLVLLLSPFIVSHALQDSFLKCLSRTSESSFPFSTVLYTPKNSSFTSVLQSSAQNLRFT 70 Query: 721 APSVSKPLLIF 753 P+V KP IF Sbjct: 71 LPAVPKPEFIF 81 >ref|XP_002330562.1| predicted protein [Populus trichocarpa] gi|222872120|gb|EEF09251.1| predicted protein [Populus trichocarpa] Length = 543 Score = 75.5 bits (184), Expect = 1e-11 Identities = 37/71 (52%), Positives = 47/71 (66%) Frame = +1 Query: 541 LVLLFAISSAAASTLLQDKFYQCLSQKSNIPIPFSPTFYTPNNSSFTSILESTALNLRFT 720 ++L+ +S S LQD F +CLS+ S PFS YTP NSSFTS+L+S+A NLRFT Sbjct: 11 ILLVLLLSPFIVSHALQDSFLKCLSRTSESSFPFSTVLYTPKNSSFTSVLQSSAQNLRFT 70 Query: 721 APSVSKPLLIF 753 P+V KP IF Sbjct: 71 LPAVPKPEFIF 81