BLASTX nr result
ID: Bupleurum21_contig00027662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00027662 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN60437.1| hypothetical protein VITISV_035177 [Vitis vinifera] 65 6e-09 emb|CAN79493.1| hypothetical protein VITISV_033374 [Vitis vinifera] 64 1e-08 emb|CAN78588.1| hypothetical protein VITISV_043911 [Vitis vinifera] 56 3e-06 >emb|CAN60437.1| hypothetical protein VITISV_035177 [Vitis vinifera] Length = 818 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = -2 Query: 329 LPSFEDSWEQFEVISAQFPQFNLEDKVRVWVAGNVRPPTNFTYVRRKKQ 183 LP FE +WE F I QFP+F+L ++V VW GN RPP +FTY RR K+ Sbjct: 764 LPDFEATWESFAAIQNQFPEFHLANRVAVWEGGNYRPPVHFTYARRDKK 812 >emb|CAN79493.1| hypothetical protein VITISV_033374 [Vitis vinifera] Length = 455 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/48 (58%), Positives = 32/48 (66%) Frame = -2 Query: 329 LPSFEDSWEQFEVISAQFPQFNLEDKVRVWVAGNVRPPTNFTYVRRKK 186 LP FE +WE F I QFP+F+L DKV VW GN +PP FTY RR K Sbjct: 405 LPDFEATWESFATIQNQFPEFHLVDKVVVWEEGNDKPPVRFTYARRAK 452 >emb|CAN78588.1| hypothetical protein VITISV_043911 [Vitis vinifera] Length = 2232 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/50 (50%), Positives = 31/50 (62%) Frame = -2 Query: 332 GLPSFEDSWEQFEVISAQFPQFNLEDKVRVWVAGNVRPPTNFTYVRRKKQ 183 GLP FE SWE + I FP F+LEDKV + GN RPP + Y R+ K+ Sbjct: 1978 GLPQFEASWESVDTIKEHFPDFHLEDKVSLIEGGNDRPPIRYVYNRKGKR 2027