BLASTX nr result
ID: Bupleurum21_contig00027208
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00027208 (458 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003542788.1| PREDICTED: 80 kDa MCM3-associated protein-li... 57 2e-06 >ref|XP_003542788.1| PREDICTED: 80 kDa MCM3-associated protein-like [Glycine max] Length = 405 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/45 (55%), Positives = 30/45 (66%) Frame = +3 Query: 3 EVDLEAFCTDCGLQTTLDEVGRRFLPTKQTSFVHPKRSLQNHYLL 137 E DLE+FC CGL+T DE G + LPTKQT+F HPK Q + L Sbjct: 354 ESDLESFCNHCGLETGTDESGNKLLPTKQTTFSHPKGGFQRYSFL 398