BLASTX nr result
ID: Bupleurum21_contig00027185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00027185 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278873.2| PREDICTED: lamin-like protein [Vitis vinifera] 55 8e-06 emb|CBI22266.3| unnamed protein product [Vitis vinifera] 55 8e-06 >ref|XP_002278873.2| PREDICTED: lamin-like protein [Vitis vinifera] Length = 164 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +3 Query: 3 DVYNLTEAKQFYFLSSGGYCFHGMKLAVNV 92 DV+NLT + +YFLSSGGYC+HGMKLA+NV Sbjct: 92 DVFNLTHPRPYYFLSSGGYCWHGMKLAINV 121 >emb|CBI22266.3| unnamed protein product [Vitis vinifera] Length = 176 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +3 Query: 3 DVYNLTEAKQFYFLSSGGYCFHGMKLAVNV 92 DV+NLT + +YFLSSGGYC+HGMKLA+NV Sbjct: 104 DVFNLTHPRPYYFLSSGGYCWHGMKLAINV 133