BLASTX nr result
ID: Bupleurum21_contig00027119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00027119 (377 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD83473.2| ribosomal protein S19 (mitochondrion) [Nicotiana... 55 4e-16 sp|P27527.2|RT19_PETHY RecName: Full=Ribosomal protein S19, mito... 55 5e-16 gb|AAR01944.1| ribosomal protein S19 [Cycas revoluta] gi|3080724... 56 6e-15 ref|YP_173409.1| ribosomal protein S19 [Nicotiana tabacum] 52 2e-14 ref|YP_002608369.1| ribosomal protein S19 [Vitis vinifera] gi|22... 52 2e-14 >dbj|BAD83473.2| ribosomal protein S19 (mitochondrion) [Nicotiana tabacum] Length = 94 Score = 54.7 bits (130), Expect(2) = 4e-16 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -3 Query: 360 QRSVWKEPFIDAFLQKMNMKGEKLANRKIWSRRSTILP 247 +RS+WK F+DAFL +M K + L NRKIWSRRS+ILP Sbjct: 3 RRSIWKGSFVDAFLLRMKKKRDPLFNRKIWSRRSSILP 40 Score = 54.7 bits (130), Expect(2) = 4e-16 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -1 Query: 128 ITEGKVGHKFGEFSFTRKRRPKRDNVAP 45 ITEGKVGHKFGEF+FTRKRRP R N+ P Sbjct: 60 ITEGKVGHKFGEFAFTRKRRPSRTNIGP 87 >sp|P27527.2|RT19_PETHY RecName: Full=Ribosomal protein S19, mitochondrial Length = 94 Score = 54.7 bits (130), Expect(2) = 5e-16 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -1 Query: 128 ITEGKVGHKFGEFSFTRKRRPKRDNVAP 45 ITEGKVGHKFGEF+FTRKRRP R N+ P Sbjct: 60 ITEGKVGHKFGEFAFTRKRRPSRTNIGP 87 Score = 54.3 bits (129), Expect(2) = 5e-16 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -3 Query: 360 QRSVWKEPFIDAFLQKMNMKGEKLANRKIWSRRSTILP 247 +RS+WK F+DAFL +M K + L NRKIWSRRS+ILP Sbjct: 3 RRSIWKGSFVDAFLLRMKKKRDLLFNRKIWSRRSSILP 40 >gb|AAR01944.1| ribosomal protein S19 [Cycas revoluta] gi|308072485|dbj|BAJ22104.1| ribosomal protein S19 [Cycas taitungensis] Length = 93 Score = 55.8 bits (133), Expect(2) = 6e-15 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -3 Query: 360 QRSVWKEPFIDAFLQKMNMKGEKLANRKIWSRRSTILP 247 +RS+WK F+DAFL KM K E +++RKIWSRRS+ILP Sbjct: 3 RRSIWKGSFVDAFLLKMRSKRENISSRKIWSRRSSILP 40 Score = 49.7 bits (117), Expect(2) = 6e-15 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = -1 Query: 128 ITEGKVGHKFGEFSFTRKRRPKRDNVAP 45 ITEGKVGHKFGEF+F RKR+P R ++ P Sbjct: 60 ITEGKVGHKFGEFAFARKRKPSRTDIGP 87 >ref|YP_173409.1| ribosomal protein S19 [Nicotiana tabacum] Length = 94 Score = 52.4 bits (124), Expect(2) = 2e-14 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -3 Query: 360 QRSVWKEPFIDAFLQKMNMKGEKLANRKIWSRRSTILP 247 +RS+WK F+DAFL +M K + L NRKIWSRRS+I P Sbjct: 3 RRSIWKGSFVDAFLLRMKKKRDPLFNRKIWSRRSSISP 40 Score = 51.6 bits (122), Expect(2) = 2e-14 Identities = 22/28 (78%), Positives = 24/28 (85%) Frame = -1 Query: 128 ITEGKVGHKFGEFSFTRKRRPKRDNVAP 45 ITEGKVGHKFGEF+ TRKRRP R N+ P Sbjct: 60 ITEGKVGHKFGEFASTRKRRPSRTNIGP 87 >ref|YP_002608369.1| ribosomal protein S19 [Vitis vinifera] gi|224365670|ref|YP_002608397.1| ribosomal protein S19 [Vitis vinifera] gi|147822621|emb|CAN61887.1| hypothetical protein VITISV_030711 [Vitis vinifera] gi|209954166|emb|CAQ77613.1| ribosomal protein S19 [Vitis vinifera] gi|209954194|emb|CAQ77657.1| ribosomal protein S19 [Vitis vinifera] gi|239764767|gb|ACS15236.1| ribosomal protein S19 [Vitis vinifera] Length = 94 Score = 52.4 bits (124), Expect(2) = 2e-14 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -3 Query: 360 QRSVWKEPFIDAFLQKMNMKGEKLANRKIWSRRSTILP 247 +RS+WK F+DAFL +M K + L NRKIWSRRS+I P Sbjct: 3 RRSIWKGSFVDAFLLRMKKKRDLLLNRKIWSRRSSISP 40 Score = 51.6 bits (122), Expect(2) = 2e-14 Identities = 22/28 (78%), Positives = 24/28 (85%) Frame = -1 Query: 128 ITEGKVGHKFGEFSFTRKRRPKRDNVAP 45 ITEGKVGHKFGEF+ TRKRRP R N+ P Sbjct: 60 ITEGKVGHKFGEFASTRKRRPSRTNIGP 87