BLASTX nr result
ID: Bupleurum21_contig00027088
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00027088 (348 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531626.1| conserved hypothetical protein [Ricinus comm... 58 9e-07 >ref|XP_002531626.1| conserved hypothetical protein [Ricinus communis] gi|223528744|gb|EEF30754.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 57.8 bits (138), Expect = 9e-07 Identities = 32/99 (32%), Positives = 47/99 (47%) Frame = -3 Query: 343 LYIIITCMYFTNCNVQALRILQENEQPSGDAKKLVRENDQIQQVRKIKSEADHFRQLFNG 164 L ++ ++C +A+R +N + + +RE + S+ D FR+ F+G Sbjct: 23 LIFLLQIWICSDCKAEAIRAFPDNSNSNNSNMEKLRERRRNIPADHNASKVDLFRKFFDG 82 Query: 163 RVXXXXXXXXXXXXXXXXXXKGFQDNKRRVPSCPDPLHN 47 RV GF+DNKRRVPSCPDPLHN Sbjct: 83 RVSSFNNRTEK----------GFEDNKRRVPSCPDPLHN 111